SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301609344|gb|XP_002934223| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301609344|gb|XP_002934223|
Domain Number 1 Region: 440-700
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-51
Family YWTD domain 0.00000015
Further Details:      
 
Domain Number 2 Region: 26-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 3 Region: 146-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000759
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 4 Region: 233-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00041
Further Details:      
 
Domain Number 5 Region: 323-434,705-748
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000596
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 270-310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000916
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 7 Region: 185-223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 68-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 9 Region: 105-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00034
Further Details:      
 
Domain Number 10 Region: 315-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301609344|gb|XP_002934223|
Sequence length 868
Comment PREDICTED: very low-density lipoprotein receptor [Xenopus (Silurana) tropicalis]
Sequence
MSRSWRGVVLLLLLCCLHPDLGLVHATKTLCEGSQFQCANGHCITSLWKCDGDEDCSDGS
DESSCVKKTCAETDFVCNNGLCVPRRWECDGDPDCEDGSDETAELCHMRTCRATEISCGA
RSTQCIPLSWKCDGESDCPNAEDEENCGNITCSPAEFTCSSGRCISSTFVCNGQNDCSDG
SDEENCVPPTCGAHEFQCKNSSCIPLNWVCDDDSDCADHSDESLEQCGRQPIAPQKCSAN
EMPCGSGECIHKKWRCDGDPDCKDKSDEMNCPSRTCQPDQFKCEDGNCIHGSRQCDGVRD
CLDGTDEIRCKNVNQCSGPGKFKCRSGECIDIAKVCNKQKDCKDWSDEPIKECYVNECEV
NNGGCSHLCHNLVIGYECDCTAGFKLIDRKTCGDIDECQNPEICSQICVNLKGGYKCECS
KGYQMDPSTGVCKAVGREPCLIFTNRRDIRKVGLERKEYIQLVEQLRNTVALDADIKEQS
LFWADTIQKAIFRAPFDTREKVGTHIKVVEDVHSPSAIAIDWIYKNIYWMDTGLKTISVS
NFDGSKRKTLFNSGLQDPTSIAVDPISGFIYWSDWGEPAKIEKAGMNGIDRQQFVTADVQ
RPSGIAIDVVKSRLYWVDSKLHTLSSVDLNGLDRRVILKSHEFLAHPLALTIFEDRVYWI
DGENEAIYGANKFSGQELETLVNNLNEAQDVIVYHELVQPLGRNWCNEQIENGGCKYLCL
PAPQISDNSPKYTCVCPDGFELNGGRSCRPGSKATMDHTVKPTGILPKKPLPSGDNDTNS
IHEVNLSAKGTSAAWAILPLLLIAMAASGGYLMWRNWQQKNMKSMNFDNPVYLKTTEEDL
AIDIGRHGGNIGHTYPAISVVNTDDDLS
Download sequence
Identical sequences F7CYF4
ENSXETP00000025606 ENSXETP00000025606 gi|301609344|gb|XP_002934223| XP_002934223.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]