SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301609492|gb|XP_002934294| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301609492|gb|XP_002934294|
Domain Number 1 Region: 429-673
Classification Level Classification E-value
Superfamily vWA-like 8.89e-66
Family Trunk domain of Sec23/24 0.00011
Further Details:      
 
Domain Number 2 Region: 677-772
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.19e-34
Family beta-sandwich domain of Sec23/24 0.0021
Further Details:      
 
Domain Number 3 Region: 169-447
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.97e-34
Family beta-sandwich domain of Sec23/24 0.0037
Further Details:      
 
Domain Number 4 Region: 879-1020
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.56e-30
Family C-terminal, gelsolin-like domain of Sec23/24 0.0017
Further Details:      
 
Domain Number 5 Region: 774-878
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 7.32e-28
Family Helical domain of Sec23/24 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301609492|gb|XP_002934294|
Sequence length 1024
Comment PREDICTED: protein transport protein Sec24D-like [Xenopus (Silurana) tropicalis]
Sequence
mshqgyvapppfsqsqpglggyppgygspmmsppyanyggtsptnptqpamlksavsfgs
qpplntptsapnnsqngpnfsgnimprvhgppapnntsfsyppyghppshtnstvptpvh
qvtnqlnnmqignygppsssssqippgppmpaaypgqtrpmpvppgpyfppplsnnqngl
psepflqtgnmqegiaghqnflsqnqaqpqigypppnsnnyggqlpgstlsypgafpgnq
pqmsgppqrktdpdsipspiqvidsdkinragqvyttnvrgqvpplvttectiqdqgnas
pryircttycfptssdmakqsqiplavvikplavvpknetpiyivnhgetgpircnrcka
ymcpfmqfieggrryhcgfcscvndvppfyfqhldhigrrvdhferpelslgsyeyvatl
dycrknkppnppayifmidvsynnikngvvrliceelkillenlpreenaessairvgfv
tynkvlhfynvnsnlaqpqmmvvtdtaevflplldgflvnfnesksvinnllsqipemfa
dtnesetvfapiiqagmealkasecvgklfifqsslptaeapgklrnrddrklvntekek
ilfmpqsnvyenlakecvangccvdlflfpnqhidvasmgivtmqtggtlykysqfqvht
dgqqfisdlrkdiekhvgfdaimrvrtstgfratdffggiymsntsdvemagvdcdkavt
vefkhddklsedtgaliqcallytsisgqrrllihnislncssqmadiykscetdvlinf
faksaykamlhhplktvrdvlisqtahmlacyrkncaspsavsqlilpdsmkllpvymnc
llknevligspevptdertfqrqlvmcmdvassqiffypqllpihtmdlkddtiptpvrc
seerlseggifllanginmflwlgfnsppefiqgifnvpsfahitpeatslpavdsahsk
klrsimdaiqktcpysmklilvkqkdkaemgfrqmlvedkgllggasymdflccvhkeir
qllt
Download sequence
Identical sequences gi|301609492|gb|XP_002934294| XP_002934294.1.99540 XP_004911162.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]