SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301609784|gb|XP_002934450| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301609784|gb|XP_002934450|
Domain Number 1 Region: 386-570
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.11e-60
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 296-348
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000196
Family Pan module (APPLE domain) 0.026
Further Details:      
 
Weak hits

Sequence:  gi|301609784|gb|XP_002934450|
Domain Number - Region: 126-170
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0049
Family Pan module (APPLE domain) 0.043
Further Details:      
 
Domain Number - Region: 219-245
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0124
Family Anti-platelet protein 0.056
Further Details:      
 
Domain Number - Region: 41-89
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0157
Family Pan module (APPLE domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301609784|gb|XP_002934450|
Sequence length 572
Comment PREDICTED: plasma kallikrein-like [Xenopus (Silurana) tropicalis]
Sequence
mtcyycllvfllfftlgsggciselyqdsywqggdlrsvfapdveycqlvctfsprclmf
sylpaswpkenerfacylkesatnmlpkvtltgaisghslktckskinvcrdknfhgidm
igtnynvtwatnvqqckegctndihcqyftyvteqfhsapmrnrcyfkysakgmptrirl
ldnvisgfslkacgksslgcqndlfqnmelpgetltrvfapdvhtcqkictfypnclfft
fykkeskeplqrnvcyirtstkgipdeginkehtisgfsllsckfspsvcpltilsdaef
lgdellveevsgekecqqectnnircqfftyrpmqsgcsenkckchmkissnglptgirh
gngeisgfslrlckiksvkgnnphplpqmwiiysgvvklsnitqstpfseteqiiihphy
tgagngtdiallklktpisfndhqkaiclppreptfvlpnscwitgwgfteesgslsnil
qkaevppisteecqgnyeqtridkkilcagykrgkidsckgdsggplacvvdeiwyltgi
tswgegcarpgkpgvytrvseftdwiiehtrv
Download sequence
Identical sequences gi|301609784|gb|XP_002934450|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]