SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301609956|gb|XP_002934523| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301609956|gb|XP_002934523|
Domain Number 1 Region: 415-704
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-82
Family Protein kinases, catalytic subunit 0.000000000148
Further Details:      
 
Domain Number 2 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-41
Family Second domain of FERM 0.000000385
Further Details:      
 
Domain Number 3 Region: 32-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-40
Family First domain of FERM 0.00000445
Further Details:      
 
Domain Number 4 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-36
Family Third domain of FERM 0.00000165
Further Details:      
 
Domain Number 5 Region: 917-995
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 4.45e-29
Family FAT domain of focal adhesion kinase 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301609956|gb|XP_002934523|
Sequence length 1108
Comment PREDICTED: focal adhesion kinase 1 [Xenopus (Silurana) tropicalis]
Sequence
maaayldpnlnhtpstnaksrlstgmerspgaiervlrvfhyfesnnepttwssnirhgd
atdvrgiiqkivdshkvknvasfglrlshlhseevhwlhpdmgvshvrekyeqshppeew
kyelrirylpkgflnqftedkptlnffyqqvkndymseiadqvdqeialklgcleirrsy
gemrgnalekksnyevlekdvglkrffpkslldsvkaktlrkliqqtfrqfanlnreesi
lkffeilspvyrydkecfkcalgsswiisvelaigpeegisyltdkgsnpthladftqvq
tiqyssseekdrkgmlqlkiagapepltvtapsltiaenmadlidgycrlvsgasesfii
rpqkegeralpsipklansekhgvrahavsvsdefsgdetddyaeiideedtytmpstgd
yeiqrerielgrcigegqfgdvhqgvymspenpamavaiktcknctsdsvrekflqealt
mrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstal
ayleskrfvhrdiaarnvlvsssdcvklgdfglsrymedstyykaskgklpikwmapesi
nfrrftsasdvwmfgvcmweilmygikpfqgvknndvigriengerlpmppncpptlysl
mtkcwaydpsrrprftelkaqlstileeeklqqeermrmesrrqvtvswdsggsdeappk
psrpgypsprssegffpspqhmvqpnhyqvsgfsishgipsmsgnlypgqasvidhmdsw
nhrtpdinmwqpgmedsgpmdlrsmaqvlpthlmeerlirqqqemeedqrwlekeerflk
pdvrlsrgsvdhvdgnlqcpagnqhiyqpvgkpdhsappkkpprpgapshlgnlpahnsp
vdsynegvkpwriqpqeisppptanldrtndkvyenvtglvkaviemssriqpappeeyv
pmvkgvglalrtllatvdetipvlpasthreleeetfdlnvesfwqkahmaeiqkdwnqv
gfdkihpfsegkfqpfppvhqnrcgfqlalpnllgiialakfdtknfnfglghwediqki
egrislphpesftlilinqgprgprvvp
Download sequence
Identical sequences gi|301609956|gb|XP_002934523|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]