SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301610186|gb|XP_002934640| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301610186|gb|XP_002934640|
Domain Number 1 Region: 73-382
Classification Level Classification E-value
Superfamily L domain-like 4.25e-64
Family Internalin LRR domain 0.0056
Further Details:      
 
Domain Number 2 Region: 318-586
Classification Level Classification E-value
Superfamily L domain-like 1.29e-54
Family Internalin LRR domain 0.023
Further Details:      
 
Domain Number 3 Region: 531-707
Classification Level Classification E-value
Superfamily L domain-like 1.5e-28
Family Internalin LRR domain 0.07
Further Details:      
 
Domain Number 4 Region: 710-798
Classification Level Classification E-value
Superfamily DEATH domain 0.000000459
Family DEATH domain, DD 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301610186|gb|XP_002934640|
Sequence length 813
Comment PREDICTED: leucine-rich repeat and death domain-containing protein LOC401387 homolog [Xenopus (Silurana) tropicalis]
Sequence
meptqllgakrnrlsltlmqkksefrfhgmrkqlqflywaqllgtgseqcgftgmperdt
erlpssisvwvednlknlvpsdsnnmprtvpsgtgsitsinlnskelteippdvfrctnl
qclllsnnfmthlptslchlskleilslegnalvslppeicslsqltalnvnhnqiavlp
heisglknikqlfannnklsqlppclgdlttlqvlcisgnsmktlpdstaslknlhvlnl
dgnqisalpkavfrlsqlvklclsgnqikslpkeigdlknlrelslssnqltflpvqlyn
ltsleeltlddnkltaisdklqnlkqlkvlsiannlltditekvcwcpaieclklngnqm
yrlptkihnlrnlkelhiernalemlpdqlahlnnlsvivcannnllwipielkncnqit
kldlsgnklsevpqalssmtsllylnlnqneiheiansiihnrklehlelsgnkltvfsv
hfcglhnlayldlsrneinsvpsaisnleslselllhsnkfrrfpielcalkslqkidls
gnqietvpsgislleglryvnlsnnsfkvfprelfsvssletlkisqkdgrklislpdel
sklknlkeleisdnniktlpgsigemknlvqltatsnqlyhlpasisslaalqqlslkgn
qltslpsdisglqklreinldsnpmlrppsllcdgkrlypigrylqsadlrdekilqktf
klisnnipaedfsffckklrikdeevkgivknrslqlpdkilqvlnmwkserhpqtaped
iaeqlirvllmcdlhsaalkanvfkintkaikf
Download sequence
Identical sequences gi|301610186|gb|XP_002934640|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]