SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301610325|gb|XP_002934688| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301610325|gb|XP_002934688|
Domain Number 1 Region: 240-511
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-83
Family Protein kinases, catalytic subunit 0.000000000683
Further Details:      
 
Domain Number 2 Region: 129-273
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-39
Family SH2 domain 0.00000782
Further Details:      
 
Domain Number 3 Region: 67-139
Classification Level Classification E-value
Superfamily SH3-domain 2e-24
Family SH3-domain 0.0000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301610325|gb|XP_002934688|
Sequence length 519
Comment PREDICTED: tyrosine-protein kinase Yes-like [Xenopus (Silurana) tropicalis]
Sequence
MGCKQCKEDKVEKVEENALEIPQRYCPDPTSQMPFRIQETHTPFISAGIGGVIAGSSQRG
MGVGVTGGVTQFIALYDYDARTEDDLTFKKGEKFHIINNSEGDWWEARSLSSGNTGYIPS
NYVAPMNSIQSKDWYFGKIGRKDAERLLLCEGNPRGTFMIRESETTKGAYSLSVRDWDAT
RGDHAKHYKIRKLDNGGFYITTRVQFDTVEELVEHYSEFNDGLCHLLTNPCINQKPQTLG
LSKDAWEITRDSISLDKKLGQGCFGDVWKGTWNGTTNVAVKTLKPSTMSPEAFLEEAQIM
KKLRHDKLVQLYAVVSEEPIYIVTEFMTKGSLLDYLKEGEGHLLKLPQLVDMSGQIASGM
AYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAA
LYGKFTIKSDVWSFGIMVCELVTKGRIPYPGMSNREVLEQVERGYRMPAPPACPPSLHEL
MLQCWRGDPEERPTFEYLQSFLEDYFTATEPQYQPGDNI
Download sequence
Identical sequences XP_002934688.1.99540 XP_004911606.1.99540 XP_012813789.1.99540 XP_012813790.1.99540 gi|301610325|gb|XP_002934688| 8364.ENSXETP00000044646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]