SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611074|gb|XP_002935069| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611074|gb|XP_002935069|
Domain Number 1 Region: 602-659
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000196
Family BSTI 0.047
Further Details:      
 
Domain Number 2 Region: 986-1045
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000111
Family BSTI 0.05
Further Details:      
 
Domain Number 3 Region: 1375-1434
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000311
Family ATI-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|301611074|gb|XP_002935069|
Domain Number - Region: 261-315
Classification Level Classification E-value
Superfamily FnI-like domain 0.0046
Family Fibronectin type I module 0.02
Further Details:      
 
Domain Number - Region: 650-703
Classification Level Classification E-value
Superfamily FnI-like domain 0.00617
Family Fibronectin type I module 0.059
Further Details:      
 
Domain Number - Region: 2093-2131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 904-961
Classification Level Classification E-value
Superfamily Translational regulator protein regA 0.0915
Family Translational regulator protein regA 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301611074|gb|XP_002935069|
Sequence length 2161
Comment PREDICTED: LOW QUALITY PROTEIN: alpha-tectorin-like [Xenopus (Silurana) tropicalis]
Sequence
mvlsmsrchtselkivedaerigifvssaqsreilypfwqndtktpkvddgssaeiklsi
pfiffgvpyrtlyvnnngvisfnvllsqftpeafplsdgrafiapfwadvhngirgeiyy
kettdpamlkkiskeirkhfrnlpyftatwvfsvtwdevtfyggssttpvntfqallisd
gassfsmfnyaeitwttgtasggdpltglggvmaqagfnggngtnffsvpssrspeivni
eettnvnvpgrwlyridgkeidpangcslkgnflrqgesfwesancsmrcrcldinneis
cqesvcgpyevcepkdkffqclpvesstcvvfgdphyhtfdgllfhfqgscsyllarhcw
pgnhlpffsveaknenrggssvswlkdislevysynivipknsfgkvkvnnlifslpvnl
eygaikiyqsglstavetdfgllvmydgqhyasisvpgtyinstcgmcgnynknptddtl
rsdgrpavsvvdlgeswrvyhpdwrcspgcldncsscdatteslyfsseycgfinmtgsp
lwecgsvvdptafvhscvydlcgsgdngtsfcqsiqayalvcqalgipvgdwrtqtscas
avqcpefshysvctsscpatcadiiaplycnspctegcecdegyvlsadacvpvskcgce
mdgkyymvgdsfwtsadctvqcwcedggdvscfnntcrdgeicsiengyqgcyprresvc
lisqnqvihtfdsvtfpfpldysytlvktcpekaefieidiskkkpdsspnwlrplriqv
akqdirigggsnseikingfevelpfylpsgeleiyrnrngtviesesyvkiqysdqgli
hvtlstfyhnctgglcgyfngnpddefcfpngkctdnvaifleswttfdeicngecgdll
kacnndsellkyyksrskcgiindptnssfldchavvnvsayyrtclfrlcqsggnqtel
cdsvsryamacqnaavdvgqwrsksfcplvcpenshfdecitctetcdtlasgpvcsdsc
tegcqcdegfalrgsycvpksecgcsyeghqvstnatfwadldcksfcycngsdnsiyce
stpckedeycmednglyfcqprtdascivsgyghyltfdglpfdfqsscslilcttasnf
kadvypkftvtaknedrdpslalwvkqvevevynyniiiyraykhtvlvnnerlylplrl
ghgkvnifafgfhivvetefglkvvydwktflsvtipramqnstyglcgryngnieddlq
tsngfvstnvnefgqswvkrdtfcqvgcgdrcptctkvdglwkaqqlcsfipnrnsvfak
chskvnpsfffknclfdscidggavqtacswlqnyastcqtqgiavtgwrnytscyitcp
ayshyescvsvcqprcaairlksdcnhycvegcqcdpgyvlngkscilphncgcyadgky
yepkqlfwnsdctrrcrcfgrnliqcdprhcksdeecalrngvrgcftkkssyciaaggg
vfrtfdgaflrfpancafvlsticqklpdisfqliinfdkwsspnqtvispvyfyineeq
ilindrntvkvngtqvtvpfvtglstkiysmegflvidtspdiqiyyngfnvikisiser
lqnkvcglcgnfngdltddyvtlrgkpvvssvvlaqswktngmqkrxehsplcnelqysq
yaakcdnvqiqalqsdgyclkltdmkgffqpcyglldpvpfyescfldgcynnrkhqlcg
slaaygeacrsfgilstewiekencsgviedpcvgadcpnrscevdnggelcgcmdppay
gndthdiidaevtckaaqmevsiskcklfqlgferegvrindrhcpgiegedfisfqinn
tkgncgnivqsngthimykntvwiesanntgniitrdrtinvefscayeldikisldsvi
rpmlsvinltvptqegsfttkmalyknasykhpyrqgevvlttrdvlfvgvfvvgadsth
lilvlnkcyatpsrdsndklryfiieggcpnikdntigieengmsltcrfhvtvfkfigd
ydevhlhcsvslcdaeknscrvncpqnsrsasdltqdskeqiisvgpirrkrldwcedng
gceqictsrldgplcscvtgtlqedgrscrvssssaerhgwlvpliinqisvwvfiyktk
q
Download sequence
Identical sequences gi|301611074|gb|XP_002935069|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]