SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301611992|gb|XP_002935503| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301611992|gb|XP_002935503|
Domain Number 1 Region: 1264-1321
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 41-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 1088-1145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000667
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 1146-1202
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 1324-1376
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000484
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1206-1259
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000523
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 7 Region: 1035-1085
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000602
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301611992|gb|XP_002935503|
Sequence length 1426
Comment PREDICTED: thrombospondin type-1 domain-containing protein 4-like [Xenopus (Silurana) tropicalis]
Sequence
mysfgyiflslmivhlchtrekvssrtprqtledegagnkisglwgtwgpwsscsqtcgl
gviersrsclspykqvpwvpgaepaphimqsipqpspndersnvypfgaarpayplhtdg
eiaapfvdlgaqrhspalrynpfnrhtrqgihssgsqppvqnhdsspyhrstssrgraaa
rhpqtgwhpapletpylqeellapetfsmhrndhqsipssynrrnitrqvedpapwpffp
dsipllkpessedhnpgrsfppltptkesrfsrrsrvrnsikpgkygygkvpfalplhkd
keesqrfkrhhksldggateeeehleptqipsindrevydthnadssvihspepskqkss
lshkgdlphhhlpdrkqktvhehsswpetlvnisllmglsgfqqkalkgdesrhesmetd
vapvepvqeeglshrrsqsnqndqllseirywgsekdserhgdqnigsekqveeahlsri
aktrkvrspntrvfwadekqaaveqksssllssataeeiaadnskaqsdvynrngdqpfm
enrkdirrisrakmfgtvkpmqrldatkkgqnersplegsvllnerashlnshvkkitkh
sdgsdseitadeadqhhhqvasdsvllprsrsqrqsqnrhgvdnsrvfqnlfrehpsvhr
paqsdpwpafgrsptvahereqdvgsslhqnselpqwnlynpaseefhcegeqkqykscn
qeacpsgqpdarakhcatfnsqefmgrlyqweaftevsgnqrcalncrpigyrfyvrhte
kvqdgtpceagsldvcvdgqclspgcdgilgsnstldtcgvcggdgstckfitgtfketn
vpigyhkileipkgatqikvreltwspnylalrsrtgksiingnwavdpagryeaggtvf
iytqpgreeqegetftaagptsealdvymifqqdnpgisfqffissptaadasghqsnps
qqeygalrsmsasetlantgsrtqppddrplvpppqsrqrpvstlqrnirvpplqsppvh
ywpeqpqffwkrvgstacsvscgkgfwypvyqcvsrnsleevseeecdlsnkpfpqeeac
ntqpcpafwdvgnwsvcsrtcgngiqhrqvlcrqmyanrttmvhpqrcshlvkpnvtqtc
qlricshweiqsnwstcsvmcglgqrtrhvrcvsnqgdevgdgecsnrlrprtneacdmg
pcvrswfhnewslicstecgtgiqrrsvfclsssptdesqescggskpsdmrvcnsgpce
rtvkwytgpwtqcsadcgdgsqkrdvicvsklgaefnvtdpsecshlekplplqscnvgp
cgpswfttpwsacsqsclgglqmrevrclasdksfsqqcdqdtkpedkrvcntqpcsaal
dencrdryhncavvvqarlcvygyykqaccsscahavqrsvtpesr
Download sequence
Identical sequences XP_002935503.1.99540 gi|301611992|gb|XP_002935503|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]