SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301613211|gb|XP_002936099| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|301613211|gb|XP_002936099|
Domain Number - Region: 137-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0469
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301613211|gb|XP_002936099|
Sequence length 857
Comment PREDICTED: endothelial cells scavenger receptor-like [Xenopus (Silurana) tropicalis]
Sequence
maeliffllfpsssvtkelvccpgwkqegractvdtcktdevcirpgvcrckpgyfgasc
nsrcpdqywgsdckqscscfpngkcdpvsgqctcysnrwgpncqhpchcsqhgacnpltg
vchcengwwtpycnkqchcnlqtsrcsqatgqcicdtgwwgqkcsvkcncnnspclqing
rckcqegwwgvsceyqcdclhgkcsplngkcdchvgyqgascadpctpgtygtncknrcg
hckqgqicspvdglclscdpgwngthcdqpcpsgyhgencgqrcpkcrgteecnretgtc
ehcdagklgprcdskcppgsygercqylcpvciygtcdpktgecicdagfwkqscnetcp
rgyyglncsstcdcnggpcspiygtcqwtssqkgalvagvlvsvlfflfilccccccgtd
qsdsknrvsqeggtfsrmkhnfqgtlanissllpccsvgstklswvtvshhdaelpfnhs
fiespstgwlsensfssfesdeggpvycvppregmsiadldgfqeisskcnvfpdslafn
tddvsqpfsiprtssiakakrpsvsfaegtkfgsrrssatetpnlvrkpklalslpklps
ihsqsinredlthseegndfyekvcinqgpedhpkvhrnvpvgrrrtmsnaqkvalksev
vessvienvydtkrkstgvttvyvsvgppkkvykprrrsegnidgavqavlkrlgsfqkg
ipkparknlhqtsnakipqskiseeesfptdstnsnspsakfqdnqarkvlmptssilkk
ipsraeegteyvhssdklenmysslaepialleqakytehiyhttentdsepkyenisvt
kcnktndieasslyeda
Download sequence
Identical sequences gi|301613211|gb|XP_002936099|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]