SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301614734|gb|XP_002936841| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301614734|gb|XP_002936841|
Domain Number 1 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.14e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 540-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.37e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 442-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000857
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 385-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000451
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 50-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000183
Family KRAB domain (Kruppel-associated box) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301614734|gb|XP_002936841|
Sequence length 642
Comment PREDICTED: oocyte zinc finger protein XlCOF7.1-like [Xenopus (Silurana) tropicalis]
Sequence
mtikkdkkkmterivnhaleiiflltgeeyiimkknapqsihlltgevhiksgdaavyfs
teeweyierhkesykdvmmetlgtlgiptsktsgkivtevasdkeqkeesfairrldtev
qeikensgpgrskpgfepdidqsearavicvedkeqeicinddsgeineivsdienkgep
yaersledtvqiicvnadsgesssvdileesqpatcisdddtgkinpevardveekvkqc
avrclddedeevcvssgsggswsrrmsgeyqtavcishelakyesgvfhglqaenakgnl
alwkrgdtifapqpyqckenalavnekfdysseeeaikhnnrekticakgpsgkspceyy
tlaedtpfncddvsnsymsaqqighnddtvyectegekhfsydsifsrhqlihtkeepca
stdfdkcftdnphevthymdssgekpfscndcgqcftrrssllrhskfhsgdkpytclvc
gkcfsnkshlvahrrihegekpyacpecgkcfanrsylsvhkrthtgekpyscpecgkrf
tamqsvvrhrrshtgekpyacgecgkrftrrsclnrhnrshmrvkpfpcaecgqcftnka
lldahkithtgvklysctecgkcftqmaalivhhrshieenp
Download sequence
Identical sequences XP_002936841.1.99540 gi|301614734|gb|XP_002936841|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]