SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301617277|gb|XP_002938060| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301617277|gb|XP_002938060|
Domain Number 1 Region: 422-644
Classification Level Classification E-value
Superfamily vWA-like 1.56e-63
Family Integrin A (or I) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 18-210
Classification Level Classification E-value
Superfamily vWA-like 1.81e-56
Family Integrin A (or I) domain 0.00021
Further Details:      
 
Domain Number 3 Region: 212-347
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 378-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000373
Family EGF-type module 0.044
Further Details:      
 
Domain Number 5 Region: 340-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000044
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|301617277|gb|XP_002938060|
Domain Number - Region: 652-678
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00085
Family Chicken cartilage matrix protein 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301617277|gb|XP_002938060|
Sequence length 721
Comment PREDICTED: matrilin-4-like [Xenopus (Silurana) tropicalis]
Sequence
mlyistlllialaalearpqtavqkcksgpmdlvfiidssrsvrpfefetmrkfmidiin
slevglsttrvgvvqyssqvqtvfslktfsnksdmekaineiiplaqgtmtglaiqyamn
vafteeegarplskniprvaiivtdgrpqdrvtevavqareagieiyavgvqradvsslr
amashplddhvfhvesfdliqhlsiqfqdklscvdmctemdhgcqhkcvnipssyycecn
egyklnadgktcslidlcaqgnhgceqicvsspgsyscacragyqlnedkktcslidlcs
qgnhgceqicvsspgsyscacragyqlnedkktcsmidlcsqgnhgceqlcisslgsytc
acrsgyqlnndkktcsmidycsygnhscqhecvsilngyycrcnegytlqadgktcvadd
mcnivdhgcefkcvstpgsyycicpegqelqadgktcnkcstgyidlvfvidgsksvrpq
nfelvkefvinivdssaisaqgthiglvqyssrvrtefplsqytngqdiktavkniqyme
kgtmtglalkhmveqsfseaegarknvpkiglvftdgrsqddisewakkakeagitmyav
gvgkavedelneiasdpvnkhsfytadfstmnliaedlklnicpeeikgttetknpcdce
hlvsfqtstiakleslseqhilsvwqlllvsqrytnkptilidfqlnarledlenqlvsk
k
Download sequence
Identical sequences gi|301617277|gb|XP_002938060|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]