SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301618560|gb|XP_002938688| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301618560|gb|XP_002938688|
Domain Number 1 Region: 151-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.15e-53
Family Prokaryotic proteases 0.000000559
Further Details:      
 
Domain Number 2 Region: 366-461
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family HtrA-like serine proteases 0.0014
Further Details:      
 
Domain Number 3 Region: 25-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 4 Region: 88-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000103
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301618560|gb|XP_002938688|
Sequence length 464
Comment PREDICTED: probable serine protease HTRA3-like [Xenopus (Silurana) tropicalis]
Sequence
mklcawlplcalltllsgatrtgacparcdvsrcpspicpsgyvpdrcncclicaagege
pcgregdppcgdslqckpppgmrglkgscqckhtnpvcandgqtydnlcqlkaasrralq
kghspvvlvqkgacqsghqhpnsprykfnfiadvvekiapavvhielflrhplfgrnvpl
ssgsgfiisdlglivtnahvvsssntvsgrqylkvqlhngdsyeatikdidkksdiatik
iyprkklpvlllghsadlrpgefvvaigspfalqntvttgivstaqrdgkelglrdsdmd
yvqtdaiinygnsggplvnldgevigintlkvaagisfaipsdritkfmtesqdkkykan
ndgkkrfigikmltitpsfaeekklhnpdfpdvtsgiyvhevvpnspaqrggiqdgdiiv
kvngrplvtsgdlheavmnesplllevrrgnddmlfnlepevsm
Download sequence
Identical sequences XP_002938688.1.99540 gi|301618560|gb|XP_002938688|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]