SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301619043|gb|XP_002938906| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301619043|gb|XP_002938906|
Domain Number 1 Region: 440-636
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-35
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 866-1044
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.98e-35
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 259-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-34
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 670-860
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-34
Family Laminin G-like module 0.0071
Further Details:      
 
Domain Number 5 Region: 23-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-29
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 6 Region: 1077-1284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.99e-29
Family Laminin G-like module 0.00000316
Further Details:      
 
Domain Number 7 Region: 201-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000903
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301619043|gb|XP_002938906|
Sequence length 1689
Comment PREDICTED: neurexin-3-alpha [Xenopus (Silurana) tropicalis]
Sequence
mstdlhslslflrlnllicsilglslglefmglpsqwarylrwdastrsdlsfqlrtnvs
aglllyfddggicdflclsladghvqlrfsidcaetaivsdkkvndggwhflmlsrnrlr
ttlvldgeakpgevrpqrqhmnivsdlfvggvpsdirsgaltlgsvrdmsafagylldik
ygnteprllgshgarldleglctenpcenggacllldgeptcdctatgyvgkfcsedvnd
ipglahlmiddqgmaaareenvatfrgseylcydlsqnpiqsssdeitlsfktrqrngli
lhtgksadyvnlalkggavslvinlgsgafeaiveptndkfndnewhevkvtrnlrqhsg
ighamvnklhclvtisvdgiltttgytqedytmlgsddffyvggspstadlpgspvsnnf
mgclkevvyknndirlelsrlarigdtkmkiygdvvfkcenvatldpisfespeayislp
kwntkrmgsisfdfrttepnglilfthgkpqdrkdirsqkntkvdffavelldghlylll
dmgsgtikvkatnkkandgewchvdiqrdgrsgtisvntkrtpftasgeseildlegdmy
lgglpenraglilptelwtamlnygyvgcirdlfidgrsknirqlaeaqnaagvksscsr
lsgkqcdsypcknnaacrdgwnrfvcdctgtghwgrtcereasilsydggmymkiimpvv
mhteaedvslrfksqraygllvattsrdsadtlrleldggkvklmvnldcirincnsskg
petlyagqklndnewhtvrvvrrgktlkltvdddvaegtmvgdhtrlefhnietgfmtek
rfasavpssfighlqslmfngllyidlckngdidycelkarfgmrsiiadpvtfrtkasy
ltlstlqaytsmhlffqfktispdgfilfnsgdgndfiavelvkgyihyvfdlgngpnvi
kgnserplndnqwhnvvitrdnsnthtlkvdtkavtqvingaknldlkgelyiaglvqsm
ystlpklvasrdgfqgclasvdlngrlpdligdalhrsgqiergcegptttcqedscanq
gvcmqqwegftcdcsmtsysgnhcndpgatyifgksgglilytwphndrpstrtdrlavg
fsttvkegilvridsapglmdylqlhivqgkigvtfnigsqdisireesapvndgkyhvv
kytrnggnatlqvdnwpvnehypggntelhqkpklpfkisrtpedgqqdkgrpltifntq
aqiaiggmdrgrpfqgqlsglyynglkvlnmaaepnpninisgsvrlvgevpsihgttpt
tsmppemsttimettttlattttrknrsspgstltddigssaecfissddedvtdcdtgt
gtsgdelvipvlvedpldipsvatrapsitlpptfqplltiiettkdsqsvtpeeglpcl
sdqgsdgcddddglvisgygsgetfdsnlpptddedfyttlslvtdkslstsffdggfks
qapkwgskdfkpnkvsepgrtsttslppelkrstsssgmvpmvpagkmnhelkpqpdivl
lslptayeldstklrsplitspmfrnvptanptmpgsrrvpgasevvresssttgmvvgi
vaaaalcilillyamykyrnrdegsyqvdetrnyitnsaqsngalmkekqhsskgnhnkq
knkdkeyyv
Download sequence
Identical sequences gi|301619043|gb|XP_002938906|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]