SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301619402|gb|XP_002939078| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301619402|gb|XP_002939078|
Domain Number 1 Region: 321-504
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-29
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 2 Region: 34-162
Classification Level Classification E-value
Superfamily POZ domain 4.97e-25
Family BTB/POZ domain 0.0043
Further Details:      
 
Domain Number 3 Region: 555-620
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000034
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301619402|gb|XP_002939078|
Sequence length 667
Comment PREDICTED: kelch-like protein 11-like [Xenopus (Silurana) tropicalis]
Sequence
MAEATAIALIPSPQQPLPEPEPQDGAPEDWEAEMFMSGTHCTDLAWRQNEQRKQGQFCDM
TLVFGQGGREFPAHRSVLAAATDYFAPLLSGQFEESRSGRVDMKWSSEPGPDLETVEAVI
QYMYTGQIRVCTGNVHDVLDLSDRFLLLRLKEFCGEFLKKNLSLSNCVAIHSLAHMYSLT
QLALKSAEMIRRNFFMVIQDDEFYTLPFHLVRDWLSDPEITVDSEEILFEAVLKWVQRNS
EERERYFEELFRLLRLSQMKPTYLTWHVKPERLVAGNEACLKLVAEAVEGHALRSENLQP
GQFQPTANHMSAYPRFGQNMDVIMVIGGVTEGGDYLSECVGYFINEDRWVNLPHIHNHLD
GHAVTATDSYVYVAGSMEPGFAKTMERYNPNRNLWEQVSNLITRKHSFGLVSVKGNLYSI
GGHENFIPGFKDVTVYDPEQDKWQILESAPKILRDVKAVSVEDRYVYLTARTPVDTGNED
GLRTITCRYDIESNTWQDTDSLPLLDNYCAFQMSVAYTNFYDTASCCPKTYSTSVEEAQS
KINRLSPGEILESLPPEVLSIEGAAICCFKDDVFIIGGWKNSDDIDKQYRKEAYRYCAER
RRWMLLPPMPQPRCRATACPVRIPFRHLHGTQKYPMPPNLMWQKDRMRQMQEMHRQTVRL
TRSQIEC
Download sequence
Identical sequences F6U8J7
XP_002939078.1.99540 gi|301619402|gb|XP_002939078| ENSXETP00000062590 ENSXETP00000062590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]