SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301620457|gb|XP_002939596| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301620457|gb|XP_002939596|
Domain Number 1 Region: 431-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000916
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 2 Region: 303-435
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000416
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 472-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.024
Further Details:      
 
Domain Number 4 Region: 279-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  gi|301620457|gb|XP_002939596|
Domain Number - Region: 165-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00361
Family Growth factor receptor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301620457|gb|XP_002939596|
Sequence length 696
Comment PREDICTED: delta-like protein 4-like [Xenopus (Silurana) tropicalis]
Sequence
mkvdpirifgltfllilvkqvsssgvfqlelhefintngmlvngksclpncrtffkiclk
hyqtvvspgsctfgsvitpvlgsntfsikgmegftnpiklpfnftwpktfsliieafhsp
tdlsqqeikisqftiqkplnvgeewsrdiqsggsqiqlkfsyrvvcsenyygescsrlck
prddrfghyicepdgrvsclkgwkgeycaepicldgcseqngycnkpgectcrpgwqgrf
cneciphngcrhgtcqiqwqcicdegwgglfcdqdlnycthhkpckngatcmntgqgsyt
cscppgfsgvncedkirecdsnpcrnggscrdlengyrcecpqgydgshceksvlncgns
pcfnggtcrerevgasytcqcplgftgsncekkvdkctrnpclnggqcfdfgktqlcrcr
pgftgptcainiddcaknpclnggictdavndyycdcppgyrgrtcnvktiecilpcmng
gtcyigpydnncdcppgfmgslcenpiepkvdfpwvavfmgagfvgvlvllcmviitfrh
frkqplhesntmnnlsdfqkgnlipasqlkninkkkdlevdcgieksnyklknhtldcnl
thgmignvssgigkgnkfhnsekcleeekfplrfhsdkpecristicssrdsmyqsiyvi
aeernecviatedvdselfsyaefklsrspccppef
Download sequence
Identical sequences gi|301620457|gb|XP_002939596|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]