SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301621090|gb|XP_002939898| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301621090|gb|XP_002939898|
Domain Number 1 Region: 5-355
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.2e-119
Family Motor proteins 0.0000000251
Further Details:      
 
Domain Number 2 Region: 441-535
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.98e-18
Family FHA domain 0.0014
Further Details:      
 
Domain Number 3 Region: 630-699
Classification Level Classification E-value
Superfamily DEATH domain 0.00000765
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301621090|gb|XP_002939898|
Sequence length 748
Comment PREDICTED: kinesin-like protein KIF13B-like [Xenopus (Silurana) tropicalis]
Sequence
msersnvrvavrvrpmnqrekekhpvgvismsgnktilqsnatvspgkvqkgpkefafdh
cfwsaddsdpdtyagqeevfktlgegtieniyqgynvcifaygqtgsgktysmmgtddep
gliprfcrallnrksegtvrvelsymeiynekvrdllklkkskkelsvrehnilgpyveg
lsqhavstwedikllllagntcrttaatkmneessrshaiftltitqmfhnqasgtskel
hskfnlvdlagserasktgaqgkqlvesgninksltslgriisslaeckgrrlsyvsyrd
svltwllknslggnsktvmlatispaednygethstllyaerarkivnqatvnedtkcka
vatlqeevqklkdqlkhaksqqspelqsklkesenllkqlnlsweeklkkteenaremqk
ylesmgisvdasgikcakeqcclvnlnpdpesndyllyyltehnkigagssqdfqltgpg
ieeehcvitmtpdgdvflvpntraetkvngalvqeriqlyhedkinlglnysfilnqskk
rqpdppsknkheveknemssdhesinesnpkhesgiqeqhpyyqlsgsqdddneltktsh
inpkkeeistesrshdshstssiekvlallqksqesltelqqnftnlvekleskqlitqq
dcaslennedmvlkyeillniiagkgenactefldllgkdkvdmnkdndddrkeqntete
takdqsqpnndknevaekeettealnge
Download sequence
Identical sequences gi|301621090|gb|XP_002939898|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]