SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301621746|gb|XP_002940206| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301621746|gb|XP_002940206|
Domain Number 1 Region: 553-810
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.27e-79
Family Reverse transcriptase 0.00075
Further Details:      
 
Domain Number 2 Region: 15-111
Classification Level Classification E-value
Superfamily DEATH domain 1.08e-19
Family Caspase recruitment domain, CARD 0.01
Further Details:      
 
Domain Number 3 Region: 2167-2233
Classification Level Classification E-value
Superfamily Chromo domain-like 4.58e-16
Family Chromo domain 0.0086
Further Details:      
 
Domain Number 4 Region: 1091-1268
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000145
Family Reverse transcriptase 0.085
Further Details:      
 
Domain Number 5 Region: 1688-1768
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000626
Family PDZ domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|301621746|gb|XP_002940206|
Domain Number - Region: 171-433
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301621746|gb|XP_002940206|
Sequence length 2302
Comment PREDICTED: hypothetical protein LOC100497286 [Xenopus (Silurana) tropicalis]
Sequence
mdndeetskeeetkaaweniecnrhmlsryinpakltpylrqckvideqdeeevlssllf
lsrttrsgrlldilhtkgqrgyivfleslefyypelyklvtgneptrrfstivveegheg
ltqflmneviklqqqlktkeiqkcelvaksrqlddekkqlklvslelltfqerynkmkee
rnncndelikvkddnynlalryaqlseeknmavmrsrdlqleidrlkhhlnkveeectle
rnqslklkndienrpkkeqmielerenemlktkvqefqsilqggsqsvpdsdkaivdile
hdrkealedrselvnrifnlqeeirqveylrdkyleekedlelkcstllkdcemykhrmn
tvmiqleevekerdlayrlrdeaqtqysqclidkdkyrkqireleekndelriemvrkea
rivnlecklrrlskdgifpdqslprilpktvlpnskisgqeaedisdsdespddndffll
dssqkkrrmnlkgipqvcsyfrdipcntiedkgalwaftlppsdpartsldsffkamaii
yddpyrsasadsairnlrqgrsvvvylddiliysnslsdhhahiqevllrlrqnhlyaki
ekcifevslvhflgyiishkgiemdpvkvqailnwvqplslraiqrflgfanyyrqfikn
ystlvapitaltkkgadpsiwpvealtafkllkeafvsahvllhpdsalpflvevdasei
gagavlsqrhpvmnkihpcgffskkfsptemnydignrellaiklaftewrhllegakhv
vtvitdhknllyiesakrlnprqasiwqkvqsslsaavaaqkkafdkrhkaspeyqparm
vrqrsppppisvegqpeyvvsrvkspgterltdfqesqsraiqlltrrvedldnrgrrcn
lrvrglpesidqpilkqtvqaifndilgqqpandlqierihrvlrprglttekprdiicc
llsyikkeeiltkarqlkvvkygnteiailqdlswftlqqrkllkpltdvlkerqnlfrw
gypfsiqatiegkthtlttpedihpflqackaenldliewvkfvqlpkptslqhkepwme
vttpkskrrkmkilasrlnpilpewihrdqtgfvrgregkentmkiinmmcwvkehrtps
lllstdaekafdrvhwtflkkvlensgmgtmfinkimalytipraqikingilsepftir
ngtrqgcplspllyvlcmehllialrqnpdiigliikgellkiaafaddlllykpkekgg
lglpdffsyyqasivsklvedtytannkqwikienqwaghplanvvwnkekrkdlhigqn
sqiqaltdtwknlnkeynlipfpspliplvdnldfppgiidkgmnnafgiqnlqlqhvla
tateplaimtnketwtkkdswrhlqiknflkelhnlqqplrpltdlermcnrntspkhli
stvykiiiqskyanlphftrtwtqelqidlveeewekifrtvvkcsisnkfqensykils
ywyrtptqlykmrliqndkcwrcngesgtishiwytcpkvktfweqieqisseilgcqsh
yknsrhsvisttpeppgsdsilrrnkedgltpsvadedsesfdldamrldydiqercsyg
ppsihssssshqsesldsfdleqissifrklslerpfrpsitstghvrnsnttlqnvtln
gdnlmseisivggnergifisrvkpgscaekaslkegfqlllldgyikgkkqcipfdsct
keeahwtiqrcnglitihyrlnkegyrklitdleegkiisgdsfyirlnlnisnqwdsct
lsvycdevvhvldtmyqgkcewlcakvdpftdrnleagtipsysraqqiflvklkknlyr
gnrdeaenssstlsaikntqkpddivaqfdtkstsrlsrasflfgqvlqfvnrsenkykr
mnsnervrmtsststslesmkllldkqedmdsdsdikknislipyslvhpfhtekkrpvl
fapsvlakvivqkllnsggalefltckpehlepdtilpkevivaalspdllaslseaqin
lprnvpsgrffvpenlreavlsethdsrvaghpgqicqrskpsrslpqgllqplpiperp
wshismdfivdlpssnansivehfskvwqriqdslssavstqkraadrhrkespeyqpvr
vvrqrsppppvlvdgqseyeiqriidshlsrgglqflihwkgygpeerswvsatdvkadr
lirkfyakfpekprgpvapsrggkiniasskafveksfswweepvegekqktrfctplll
iveptglkpsnglrkklvflpp
Download sequence
Identical sequences gi|301621746|gb|XP_002940206|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]