SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301621829|gb|XP_002940251| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301621829|gb|XP_002940251|
Domain Number 1 Region: 353-449
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.79e-20
Family TSP type-3 repeat 0.0000171
Further Details:      
 
Domain Number 2 Region: 24-69
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000209
Family Assembly domain of cartilage oligomeric matrix protein 0.00029
Further Details:      
 
Domain Number 3 Region: 121-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 174-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000477
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 327-355
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000915
Family TSP type-3 repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|301621829|gb|XP_002940251|
Domain Number - Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-like domain of nidogen-1 0.039
Further Details:      
 
Domain Number - Region: 90-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000729
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301621829|gb|XP_002940251|
Sequence length 566
Comment PREDICTED: cartilage oligomeric matrix protein-like [Xenopus (Silurana) tropicalis]
Sequence
mlsvallssfciffgscqqlsgrgdvgpqlltemketnsvlrevrellkrqieeitflkn
tvmecdacglhgstgqhfsgpgitvtsfgnkcnpnpcfsgvtcietssgfqcgscpvgyl
gngthctdinectvnpcfprvrcvntspgfhcepcpigyigkrvegigldyarankqmcd
dlnecesgtnpcpanslctntkgsykctpckagqggacksekrcpngeiskchenadcik
erdgsivcvcavgwagngllcakdtdidgfpdeklrcsdvkckkvrkqslslhelissei
glftishphfgeysidylmflcffaeiknavdnckkipnydqkdtdgdgvgdvcdscpti
rnpdqsdadhdlvgdlcdtnqdrdgdghqdtsdncpsvvnsdqldtdkdgdgdecdeddd
ndgipdtappgpdncrivpnpdqadsddktgefrlshihkgeisignelaeehsngqfty
pfeyevhpqmdiplriflltetgmeivqtmnsdpglavevhntglcsttkgcpdeneakd
assqnqsnryfveharehmilfnnas
Download sequence
Identical sequences gi|301621829|gb|XP_002940251|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]