SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301622373|gb|XP_002940514| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301622373|gb|XP_002940514|
Domain Number 1 Region: 236-453
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-65
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 128-183,215-264
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000392
Family Hepsin, N-terminal domain 0.097
Further Details:      
 
Domain Number 3 Region: 92-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301622373|gb|XP_002940514|
Sequence length 458
Comment PREDICTED: transmembrane protease serine 3-like [Xenopus (Silurana) tropicalis]
Sequence
mdpeqkatesapaigsleivsvtreelpgvdiafsffrlffiqtkvnpgtgpsensgnde
spkchpilpakylilivalllltvlavaigltvhftcpgkircqssskcikrtercngvf
dcpegddeyrcarlsgrnsvlqaytagswrtvcsdewkglygnltckqlgfssyvssiyl
pveaveeqfrrhfvsvtpspkfagqtsllqqlinprfahynqkktsynqrkrkrlfcfcf
cfvseycssgnvitlkcvvcglrpsytssarivggnvsavgqwpwqaslvfqgvhlcggs
litpqwivtaahcvydllypewwrvqvgqvsqasesaqtavpvqkiiyhskyrsstmand
ialirlaspftfngsiqpiclpnyredfpegkicwisgwgateeggdtsqtmdyagvpli
snrvcntkyiyggvikpsmvcagfleggvdtcqvrdrg
Download sequence
Identical sequences gi|301622373|gb|XP_002940514|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]