SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301622894|gb|XP_002940761| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301622894|gb|XP_002940761|
Domain Number 1 Region: 693-955
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.41e-24
Family G proteins 0.023
Further Details:      
 
Domain Number 2 Region: 15-97
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000224
Family Pyrin domain, PYD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301622894|gb|XP_002940761|
Sequence length 1656
Comment PREDICTED: interferon-induced very large GTPase 1-like [Xenopus (Silurana) tropicalis]
Sequence
msraewekeieskiwdimvekfenlgrdsvkklkqkltykapagmkpitwrqvetaseqe
vanliirqytithgpqlaveileeinerqaslelqaalmtsnsihdtesktkqtdpeiin
tlnemiesykesklslrdildigqeninevapqtvqdlpwallrklmaldrtartvqlen
isassesdadsteeeksqhldfyskennsnyinpldilcallhcsdmllqqnifskmslc
qfavplllpagdgpectfmlwamrdivkrwrphtladskgfvegnlvqvemplfsfvrlg
qsklskskilnqvlspaqqyqdffihenmvgenikreisdglveiswflpvgrensdtfl
epvavtnlrgdiesnwtqfsfltqvssavfvfaesinerecellaqcsksntnfyfiitp
sgkgvsketsesfkklfyvlnakqshiiikekrandarlvkniqtiikhflkesikkvkl
edlsntarelgikvdensqecqkaktyaeeitkeiqdvvqykketmklqgdlwkqvaqie
kelcrmrkqgdkgteeyrsqlveelnklhreqnqhdlpdsmskfisaitylsktekhyfl
kwmqfaldsvarnnlsmlktkykvvnnnkdnnqklkqldqqisdsslgvehflremgqfy
eaecsmvsqgkikpdgrqlrnfpgiaadllldgfplelidgdasniplqwvtdllneldk
ktggkcrmrvitvlgvqstgkstllntmfglqfpvasgrctrgafmtlinvkenlkqnlg
cefilaidtqgfkapelasledidehdnelatlvvglsditiinmtmnntaemkdtlqiv
vhaflrmnniekkpncqfvhqnvsdvvahelnmrsvskflvqldemtrkaanteyksgit
kfsdimyynlerdnwyipglwygvppmasvnpgysenvyelkqylfkfmekkenlqqpkn
fvqfiewikslwnavkhvsfnfsfrnsledeaynqllmkyswwewdfrkqvhtwlisten
kinnhklqpeirrtgfkhdlisllceqekmmldllkqyfesnmdnvhliekhredfssrv
kflrsklesfatarinetiilqkgiyqiintansyqkimeeevtnlleqarerkshfgnv
eieeefetmwgraiaelpnnllqklkvskdmllelkqdmsnkgssinnnnlsikglaefg
kdefqiksqhiesgflarfvmdtkeikvnlsnlsyylirkclnyvtekdntggdydgtyc
qellnminerlreedvkelhithqfeldlklhilgkaassfqnmherfiqendpviclek
lkshywetihniyegkdetqsrakqfcelclkpaitkqiykllgkdivddimyklspkel
ssrrfsqahvlekllkdqnflqyvnyihsyegfmkqwlnqyiltkrlrklqtkilsdick
dirtvfekhqnlptvsdflkafcetlkselvisqmelqlvsfqnkvdvrqftkdieffln
etekqirseigssstesvlaklplkpeeelfdrlfgcgkqcpfckvpceaggtdhkehfa
svhrprglyykatsgelnintcsilvyckssfsdcndwdikfdhkanasaywkyvfvkfn
nefaaeydalpanlpddwctitmenaldslrktyvt
Download sequence
Identical sequences gi|301622894|gb|XP_002940761|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]