SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301623551|gb|XP_002941082| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301623551|gb|XP_002941082|
Domain Number 1 Region: 204-290
Classification Level Classification E-value
Superfamily SH2 domain 5.67e-42
Family SH2 domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 299-371
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-34
Family RING finger domain, C3HC4 0.00016
Further Details:      
 
Domain Number 3 Region: 118-203
Classification Level Classification E-value
Superfamily EF-hand 5.58e-32
Family EF-hand modules in multidomain proteins 0.0000672
Further Details:      
 
Domain Number 4 Region: 3-117
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.22e-21
Family N-terminal domain of cbl (N-cbl) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301623551|gb|XP_002941082|
Sequence length 490
Comment PREDICTED: e3 ubiquitin-protein ligase CBL-like [Xenopus (Silurana) tropicalis]
Sequence
mnkaireldllsgisavpllhrshpylpdiardtsehlkqiqakgswndhgqheylyitv
nsilrkaahcndilsanrvpqgaetearrnltklslifshilselkalfpggkfqgntyk
ickpeasqfwtskfghkclvqwsefrtglnvvhpvgsgplesalhstvdltcndyvsvfe
fdiftrlfqpwntllqnwmllavthpgymafltydevrehlkshiqkpgsyifrlscthl
gqwaigyvtskgeilqtiphnkplylallegqkeglylhpngvssnpdlselsnpstspk
vqvtqeqwdlysqmgsafelckicvdneknvrikpcghllcndcllawqksdghtcpfcr
ceiqgkeevrvlsqpeaeestmsseaigslssdltkeeedwirqrplppppvpapfipsa
pplspahsptpfglqvvspmaqrlqlqandvifgrpeahreapratnrtpplpprirwdr
hrgqhpfhta
Download sequence
Identical sequences gi|301623551|gb|XP_002941082|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]