SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301625574|gb|XP_002941979| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301625574|gb|XP_002941979|
Domain Number 1 Region: 209-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.1e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 314-440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000738
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 128-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 175-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000509
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 5 Region: 87-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000776
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301625574|gb|XP_002941979|
Sequence length 550
Comment PREDICTED: fibulin-2-like [Xenopus (Silurana) tropicalis]
Sequence
mtkdedetpewmllnvflndfiiqlccdccswglkvrkegsscesnlnlgypcnhmmilc
cngeeqlippdakipskpellvlpeadidecvlnthtciqgercvntvgsficiqeerce
sgftvvngvctdidecvinrhtcatgercvntvgsyiciqerrceigytlvdgvctdine
caslaapckqgftcvntlgsfvcqrkqlkcnkgyesdengticididecklgthncsqeq
scfnlpgshrcdckigyrydlfrkacldvnecwiypgrlchhtcentvgsykcscfagfq
lgqdgkqcedvnecksnpcnqectnvygsyqcyckegykladdgiscedidecvqnfgsl
cvfacvntpgsyqcacpetgytlsvngrtckdidecevgthncssseecyniqgsykcls
ytcpenyrkvsnmvceriscfnyqecqnspvrisylrltfpagvvvpaqifrigpsptya
gdsivldikkgneenyfssrkfnpytgiiylqrpvkkakdflldvemklfrqgvvttfls
riyvfitsps
Download sequence
Identical sequences gi|301625574|gb|XP_002941979|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]