SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301626503|gb|XP_002942431| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301626503|gb|XP_002942431|
Domain Number 1 Region: 197-469
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.29e-84
Family Protein kinases, catalytic subunit 0.000000292
Further Details:      
 
Domain Number 2 Region: 108-240
Classification Level Classification E-value
Superfamily SH2 domain 1.33e-35
Family SH2 domain 0.00025
Further Details:      
 
Domain Number 3 Region: 42-129
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000612
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301626503|gb|XP_002942431|
Sequence length 478
Comment PREDICTED: tyrosine-protein kinase Srms-like [Xenopus (Silurana) tropicalis]
Sequence
mesflreqlnclnclwdriwsplssnggvsvitphrdfnstenivtalynfdarcteelt
ieqgeelykirddgeyifarkltgmesglvpasyvaqsslpgghytiqepwymevanrne
aerlllsppnahgsflvrpsdstpghyslsvrnqdkvshfrisvsaggefyiqnerlfas
ieelinfykvnwkliksqllqpcvwvayqrdqwerprsefvlvkelgagnfgevweglwn
nkdkvaiktfkqdninesdfkkevdalktlchrnliqlyavcsvgepvyivtelmskgsl
qqflrgnegryltaanfmhiisqvaegmaylennhvvhrdlaarnvlvgeelvckvadfg
larilkddlylmhssknvpvkwtapealthgkystksdvwsygiviyevfilgqppyqgm
nnrqvldkitsgyrlpkpdlcspdiynlmlecwqekpnqrpsfydlvrkltaiqsslr
Download sequence
Identical sequences gi|301626503|gb|XP_002942431| XP_002942431.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]