SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301626505|gb|XP_002942432| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301626505|gb|XP_002942432|
Domain Number 1 Region: 212-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-81
Family Protein kinases, catalytic subunit 0.00000032
Further Details:      
 
Domain Number 2 Region: 111-243
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-34
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 3 Region: 38-158
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000407
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301626505|gb|XP_002942432|
Sequence length 502
Comment PREDICTED: tyrosine-protein kinase Srms-like [Xenopus (Silurana) tropicalis]
Sequence
mesflrehlpcfnclwdriwppkrsgvyvptvdlviqdnypsrtdrvtalysfnarsthe
ltieqgeelcmisdegeyilarkltgnmesglvpasyvaqsslpgghytiqepwymevas
rndaerllfsspnahgsflvrpsdstpghyslsvrnedkvshfcisvspggqfyiqnekv
fasieklvnfyktnwklikspllkpcvwvayqrdqwerprsefklvrqlgagnfgevweg
lwnnkdkvaiktfkqdninesdfkkevnalktlchknliqlyavcsvgepvyivtelmsk
gsllqflrgtegrhltagnfmhiisqvaegmvflekehvvhrdlaarnvlvgeklvckva
dfglarilkddlyslqgnikipikwtapevltrsiystksdvwsygivmyevymlgqmpy
qgmnntevvdkitsgyrlpkpdrcrtdiynlmlecwqeepnrrpsfsdlvgkltaiqrsl
csesiesvtsrfilevprslig
Download sequence
Identical sequences gi|301626505|gb|XP_002942432|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]