SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301627960|gb|XP_002943134| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301627960|gb|XP_002943134|
Domain Number 1 Region: 403-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000129
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 365-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000711
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 332-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000798
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 286-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000373
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|301627960|gb|XP_002943134|
Domain Number - Region: 256-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0379
Family EGF-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301627960|gb|XP_002943134|
Sequence length 566
Comment PREDICTED: protein delta homolog 2-like [Xenopus (Silurana) tropicalis]
Sequence
mavpeldpvrveplpmavpeldpvrveplpmavpeldpvrveplpmavpeldpvrveplp
mtapeldpvrveplpmavpeldplrveplpmavpeldpvrveplpmtapeldpvrveplp
mavpeldpvrvehftmtvqeldpvrveplpmavpeldpvrveplpmtapeldpvrveplp
mavpeldptlltmlcwfrlllpavslllalhwvsaqadecsercdlyhghcdqdrmcrcd
pgwdgefcedcvrmpgcahgschqpwqcmchngwagkfcdkdlhlcnhsdpcqnqgecli
dhdgefscicpepfygrtcelkrgpcekagfpclnggschdrsgfantftcrclagytge
lcqmdvddclmrpcangatchdginrfscecpsgfqgrfctiniddcagqpcqnngrcyd
rvgdyecycpegfmgksceipipkptwdeelrastkdgetahersrvtrpplvrtldtgr
ksqgtisvkevvmqverslttlqlvlvivfgtitgiaifstitvvlvyrnrsarqtahhg
yglsaaktqyqecqgsspdhrkttel
Download sequence
Identical sequences gi|301627960|gb|XP_002943134|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]