SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301628075|gb|XP_002943186| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301628075|gb|XP_002943186|
Domain Number 1 Region: 706-787
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.31e-22
Family Inhibitor of apoptosis (IAP) repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 260-340
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.88e-22
Family Inhibitor of apoptosis (IAP) repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 151-230
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.96e-21
Family Inhibitor of apoptosis (IAP) repeat 0.00077
Further Details:      
 
Domain Number 4 Region: 610-681
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 4.06e-21
Family Inhibitor of apoptosis (IAP) repeat 0.00035
Further Details:      
 
Domain Number 5 Region: 41-126
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.83e-20
Family Inhibitor of apoptosis (IAP) repeat 0.00066
Further Details:      
 
Domain Number 6 Region: 382-458
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.53e-20
Family Inhibitor of apoptosis (IAP) repeat 0.00061
Further Details:      
 
Domain Number 7 Region: 497-571
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.01e-16
Family Inhibitor of apoptosis (IAP) repeat 0.0012
Further Details:      
 
Domain Number 8 Region: 1274-1361
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000127
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301628075|gb|XP_002943186|
Sequence length 1362
Comment PREDICTED: hypothetical protein LOC100492519 [Xenopus (Silurana) tropicalis]
Sequence
mshqqisilgkedfvepvlgtkllpkipsvnkyesrgppdprdidmqskfkrylsfkdvf
gmfyrlrftsrenklanagfyyvgprdrvrcfscggqlemweewdfpltrhqqtfpecpy
lqelkakgewkdyhyepglgsnilmekplgdlsderrrletfrghsnyfpyyrqlimmaq
agfcyvgpgdlvkcficggelgqweswdvpltrhqhsfpdclyvqklaaegagiqnqkqg
htgfskekcltteppnilgkkshddmsnvysraetyrghhkhfpyikewdlaqagfyyvg
pgdlvkcficggeldkweswdkpltrhqhsfpdcayvqeqraqttgtqdqsqvcpmpike
gesgipahysgsqnpgekplgdmndeysrletyrghsqyfpmanqrklaqagfsyvgpgd
rvrciscggelekwerwdvpltrhqhsfphcpymqklrdegdgkenqskvcagpikeges
gttvplssssnlekkpcgymsdeysrlesyrghgqhfnywnqqrlakagfyyvgpkdrvr
cyscggelenwkfwdvpptqdqhspsdclhlpelflrttfmvgkqvilgmldpsipllrp
lgqvseisirtesykvakkhfpyqtsdelawagffyvgpgdrvrcfscggevdnwepgdv
pltghqlffphcsyvqglsirhsyfmeegvgpgfldtnilgkkalgdmsdeysriqsyqa
vkehfpnqtpiklawagfyyvgpkdkvqcfscggemdkwwsredpltehhrrfpqchfil
grkavsndpytmtemlkglnnqqsqptgtaapsqdgpispegnppggleegpaggmaegp
aggmaegdagrkeegpvgvmeegpvgvmeegpvgameegpvgvmeegpvgameegpvgam
eegpvgaleegavgamvegivggmeegaaggmeegaaggmeegaaegmaegaaegmegga
aegmeegaaegmelelreqeeepyswpkastmecelcgkipaatpafpiidkrkyrldlp
hgglfhccetgimfhipspsvieftlsswrdsalqrrydavgpvfdvkvisglvsavylp
hyvclkagnidvsqfkiahyiddnvvlesptsiepfyivlenptfspvgvvllramteif
kvktrihgvvhlycsyrtgytihlhfmpddcslheavkdeekehgfhfiskpygtsavft
atdytvtapdyatirpdtipvrfngdfseiyipsskmeeeieislkpgsetetnsvwgat
vrredlgsrsqeasgikhfidsnrsalidrmsvptinvvldellneeilndeqystvrsk
nisqemmrelysyanswshqdkdmfffllskhnnslvkdlmk
Download sequence
Identical sequences gi|301628075|gb|XP_002943186| XP_002943186.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]