SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|51258166|gb|AAH79937| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51258166|gb|AAH79937|
Domain Number 1 Region: 116-350
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.62e-46
Family Protein kinases, catalytic subunit 0.00098
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily DEATH domain 0.0000224
Family DEATH domain, DD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|51258166|gb|AAH79937|
Sequence length 599
Comment interleukin-1 receptor-associated kinase 2 [Xenopus (Silurana) tropicalis]
Sequence
MWSWGQKLPTLQKLVERLQKLEMYRALGILQQWSPLSVIASKVPERRKAEKESDLKTDNK
LPELTYTSPLELPTPPLPAPPPPPSDLLHSLSIQSECSLTCHSPEEVLSIPQQEKSSFSK
GLCKIWTQKDVEDATDCFCSSKIIHEGEFADVYMGHKQDKLYAIKRLKKVQDEEQKRMSS
FFHTEAQISFRCCHANILPLLGFCVEGDCSCLINQFIRNGSLDLALQQSGNHILNWERRL
KIALGFLKAIRHLHSNDILHGNIKSSNIFLDENSFPKLGHSGLRFCPDKQAGYTKAKSKD
LQVHQPYLPDSFFRHGQLTVQTDIFSCGVVLAEILTGQKACDKSRNPVYLKDLFLEELER
AKEYLDSDGKQADHESPESLCSHQISRKYIDSRAGFLSNNAAFQLSLAACLCLTKKRPLL
QEIYTWVEKADQCSRDSQNLSLNVPEESDFDDSLSLEPMEGAISKMPCTSTQGSWSMDDH
NQRNHYPKTENRDVDRTPCESDDSTLYVLPTQRSRHLVGAASAICDHQPTQSDALEQTEA
VHGNVQFSWQKSREYSDQSADSSSPSWGIIVNKEKEKLLQNFDLYRDNKLDSGSLFDSI
Download sequence
Identical sequences Q68FA5
gi|51258166|gb|AAH79937| gi|55926094|ref|NP_001007501| NP_001007501.1.99540 8364.ENSXETP00000003054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]