SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54038645|gb|AAH84174| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54038645|gb|AAH84174|
Domain Number 1 Region: 253-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-79
Family Protein kinases, catalytic subunit 0.0000000289
Further Details:      
 
Domain Number 2 Region: 715-855
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 6.15e-58
Family FAT domain of focal adhesion kinase 0.00000626
Further Details:      
 
Domain Number 3 Region: 99-204
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-30
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 4 Region: 1-96
Classification Level Classification E-value
Superfamily Second domain of FERM 7.48e-30
Family Second domain of FERM 0.0000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54038645|gb|AAH84174|
Sequence length 859
Comment PTK2B protein tyrosine kinase 2 beta [Xenopus tropicalis]
Sequence
MQQYATKVSEGMALQLGCLELRRFYKDMPQNALEKKSNFEFLEKEVGLDLFFPKQMQESL
KPKQFRKMIQQTFQQYGSLKEEECITRFMNTLSTFTSIDQETYRCELAQGWSITVDLVIG
PKGIRQLTTKDSKPTCFAEFKQIKSIKCSLLEDGWALLLLGISGAPQPLAIKTSSLAVAE
NMADLIDGYCRLQNESKDSLIVNPKKDNEKRISLPQIPTEEVQVRRSRLVEGNSMESDIY
AEIPEVTETKLTNNRFTISRSDVALGRILGEGFFGEVYDGVYVKPKGDKINVAVKTCKND
CAADVKEKFMSEAYLMRNLDHPHIVKLIGIIEDDPIWIVMELYPYGELGQYLEKNKNSLQ
VLSLILYSLQICKALAYLEGINCVHRDIAVRNILVASPECVKLGDFGLSRYLEEEEYYKA
SVTRLPIKWMAPESINFRRFTSASDVWMFGVCMWEILSFGKQPFFWLENKDVISVIEKGD
RLPKPEMCPPTLYTLMTRCWTYDPFERPKFTELVCSLSDIYQTEKEIIKDKERNNRQRPP
KIIEPPPMQEPPPKPSRPKYKAAAPGNLLAPNLLTQVPESLCASSPTLCSPTDYQSPLDS
TRSPPLPRHSIFKRRSMREEDFVKPNSKEEAQKLWEKERDKMLQVLNRQQQQMEEDGKWL
KQEEKSLANTLKDSKQKTNNNKPPDALPEKELAYTEFTVPPQKPPRLGAQSLQPLQPTPT
ANIDRTDDGVYQSVMELVKAVLQLKNDIYQLPPEGYVAVVKNVGLTLRKLIGSVDEILPS
LPQNSRTEIEGTQKLLSKDLAELINKMRLAQQNAVTSLSEECKKQMLTASHTMAVDAKNL
LDAVDQARVRANLAKVAAE
Download sequence
Identical sequences Q5XH98
gi|54038645|gb|AAH84174| gi|58332324|ref|NP_001011049| ENSXETP00000038080 NP_001011049.1.99540 8364.ENSXETP00000038080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]