SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55742037|ref|NP_001006847| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55742037|ref|NP_001006847|
Domain Number 1 Region: 21-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.09e-68
Family Eukaryotic proteases 0.00000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55742037|ref|NP_001006847|
Sequence length 245
Comment neutrophil elastase precursor [Xenopus (Silurana) tropicalis]
Sequence
MEHHLLVTLSILWASQVNGGSMHTQIVGGREATPNSHPYIASLQLRGRHFCGGSLIAPQF
LMTAAHCMENTASNLVTVVLGAHSLRANEATKQRFRVNQVFENGFNPLTLQNDIVILKLD
RPVSLNGKVQVVSLPSANEDVPAGTQCVTAGWGRLSTEGQIPDRLQELNVTVTRQNLCRP
NNICTGVFMQQAGICFGDSGGPLVCNGVIQGITSFIIRSCGNGVTPDFFSRVSLFRRFID
DAINS
Download sequence
Identical sequences Q6DF10
gi|49899920|gb|AAH76933| gi|55742037|ref|NP_001006847| ENSXETP00000046791 8364.ENSXETP00000046791 NP_001006847.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]