SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55742146|ref|NP_001006713| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55742146|ref|NP_001006713|
Domain Number 1 Region: 202-445,472-518
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-63
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 5-107
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-18
Family DEATH domain, DD 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|55742146|ref|NP_001006713|
Sequence length 721
Comment interleukin-1 receptor-associated kinase 1 [Xenopus (Silurana) tropicalis]
Sequence
MSRGSFEEEFLYRVPSQVMYRFFHIMDSLEETDWKKFASMIIPDMTELRLLEQQGSRSRT
EEVVWAWSNRNAVVGELLSILRSLNLLRALDVFESWRSRYVPESTQNFSQANPLPPPYPY
PGPESAPYFQKPQTKTDSLQTQATNPSDLPQQLPLPGPPPKAFICSSHSASTGGSSDCSG
SQIHSSVQESFLPSDVRDLPRQFVWRFQELVDGTRNFSQSLLIGEGGFGCVYKATMRNTE
YAVKRLKQDSELEWSTMKKSFLTEIEKLTCLRHPNIIDLAGYSFQGEEYCLIYLYLPNGS
LEDRLHPQGRFPKLPMEQRISILQGAACGLQYLHNYQPSIIHGDVKSSNILLDQAFMPKL
GDFGLARFSRYTSNAGNSRTLARTSTVKGTLAYLPEEYVKMGKLTFELDTYSFGVVLLEN
LTGRKAIESDSKSHTKYLKDLVKEEECKDEEEEEKGASMASGAEAKLARVAARICQYHLD
FRVWQHAKEVTQELSQLACRCLGRQKKRPNMQEVFLTLKRLQEHLHRRHLGKGHGISFTP
PCVSTRRGFSPIHELASSVQDLPLTPEENTDKYTPCGLSVKGSVQPYTPAHTQHQAKVDS
LCSSFSCQSLKTFRGAQNTPVESDESFPDFSGSDNSAGPSDQHILYPSGVQGSISPVLPR
VSVQDPIPPVQYQNQLAVQPRQRHYCNELSGSGSSTSGASQGRPRGRATHFEEHVAALLV
L
Download sequence
Identical sequences Q6DIU6
gi|49522582|gb|AAH75439| gi|55742146|ref|NP_001006713| NP_001006713.1.99540 8364.ENSXETP00000031192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]