SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56118548|ref|NP_001007911| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56118548|ref|NP_001007911|
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000000034
Family Hairy Orange domain 0.0000621
Further Details:      
 
Domain Number 2 Region: 49-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56118548|ref|NP_001007911|
Sequence length 300
Comment hairy/enhancer-of-split related with YRPW motif protein 1 [Xenopus (Silurana) tropicalis]
Sequence
MKRGHDYSSSDSELDENIEVEKESADENGNLSSAAGSMSPSTSSQILARKRRRGIIEKRR
RDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMD
YRSLGFRECLAEVARYLSIIEGMDTTDPLRVRLVSHLNNYASQREAANTAHTGIGHIPWG
GTFAHHPHLSHPLLLAQTAHTSANSTSSSTEAHHQNRLPGSPHAETSSLRVPPNGNIASV
LPVVASSKLSPPLLSSMASLSAFPFSFGSFHLLSPNSLSPTTPTPSGKPYRPWGTEIGAF
Download sequence
Identical sequences Q66KK8
8364.ENSXETP00000017194 NP_001007911.1.99540 gi|51513367|gb|AAH80349| gi|56118548|ref|NP_001007911| gi|82198482|sp|Q66KK8| gi|89272012|gb|CAJ83693|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]