SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58332348|ref|NP_001011037| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58332348|ref|NP_001011037|
Domain Number 1 Region: 425-685
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.25e-73
Family Eukaryotic proteases 0.00000798
Further Details:      
 
Domain Number 2 Region: 19-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-31
Family Spermadhesin, CUB domain 0.00000783
Further Details:      
 
Domain Number 3 Region: 184-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-28
Family Spermadhesin, CUB domain 0.0000276
Further Details:      
 
Domain Number 4 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000117
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 365-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.00029
Further Details:      
 
Domain Number 6 Region: 138-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000124
Family EGF-type module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|58332348|ref|NP_001011037|
Sequence length 687
Comment mannan-binding lectin serine peptidase 2 precursor [Xenopus (Silurana) tropicalis]
Sequence
MTEFRLLAALLILAFTFPCDVTSTELSGLFGRISSPGFPKPYSNDITMNWNIKVPEGYRI
KIYFTYFNLELSYLCEYDFVKLLSKGTEVAHFCGKESTDTEKAPGDSTFYSLDNKMTVTF
KSDYSNEKEFTGFEAFYSAEDINECKEIPESCDHFCHNHLGGFSCSCRSGFTLHSDKKIC
QAQCPDRVYKGTSGTITSPDYPDAYPKLFNCKYRIHVEEGLYIILKFLDFKVEFHQDVLC
PYDKLQITAKGKEIAVLCGETLPTDIEIKSNKVEVLFSTDDSGYHTGWKIQYTTKAIPCP
DPILPRNGNFIPDQKTYVAGNHLSLTCDKGFVLLENARTIPSFTMTCLPDGTWDKKLPKC
IIVNCGNPDDIENGTYSFVTAKEVTLYNSVVQYNCTEPYYIKEGKGEYRCGADGFWEDIE
SEKKTPPICVPDCGKRKPAAAGRIVGGEFANVGEFPWQVFINANNERGGGALLLDNWILT
AAHVVYSYDDLSSILIKMGFLSTQDSNYIRGWPEAVFIHEGYKPGHYNNDIALIKLKNKV
PLSEESILGICLPTKEKSYHISHKDDDNHVGLVAGWGLTEAQRSSRKLRFVEVNIVDHST
CKAEYAKLDAQYIVTENMICAGFEIGVKDSCAGDSGGALAFMNAESKKWFVGGIVSWGVG
CGVARQYGVYTKVTNYLDWIEKTIQAN
Download sequence
Identical sequences Q5XHB9
NP_001011037.1.99540 gi|54035177|gb|AAH84139| gi|58332348|ref|NP_001011037|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]