SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58477045|gb|AAH89660| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58477045|gb|AAH89660|
Domain Number 1 Region: 146-173,220-462
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-80
Family Eukaryotic proteases 0.000000888
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily GLA-domain 2.86e-25
Family GLA-domain 0.00027
Further Details:      
 
Domain Number 3 Region: 125-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|58477045|gb|AAH89660|
Sequence length 464
Comment MGC107878 protein [Xenopus (Silurana) tropicalis]
Sequence
MAGQTCLIILIALPAVLLQQSPNVFLKHENAHNILRAKRANSAFEEFKKGNLERECYEER
CSLEEAREVFENEEQTREFWSKYFDGDQCQSNPCQYGGSCNDGINEYTCLCNAGFEGKNC
ETVKLQLCSLNNGECDQYCKAVDRDVVCSCTNGYILGENGKSCLPTEKYSCGRRHMKRER
RETKLHENDKKNHTDSQNEVKMNQTGTLPERNVTGINILNPNDPNVRIVGGRECSQGECP
WQALLVSDEDEGFCGGTILSREFILTAAHCMNQTKYFKVVVGELNTKISEGTESIHKVEK
IIMHPRFVKSTYDYDIAVIKLKEAINFTENIIPACIPDPEFADQVLMNEPDAMVSGFGRI
HERGRQASTLQMLQVPYIKRHSCKESSTFAITENMFCAGFDTEVKDACQGDSGGPHVTPF
KGTYFVTGIVSWGEGCARKGKFGVYTKVSKLHRWLKGVLKKNQV
Download sequence
Identical sequences Q5FW21
ENSXETP00000004154 NP_001015728.1.99540 ENSXETP00000004154 gi|58477045|gb|AAH89660| gi|62751697|ref|NP_001015728| 8364.ENSXETP00000004154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]