SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62201339|gb|AAH93450| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62201339|gb|AAH93450|
Domain Number 1 Region: 68-194
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.14e-57
Family N-terminal domain of cbl (N-cbl) 0.000000345
Further Details:      
 
Domain Number 2 Region: 281-367
Classification Level Classification E-value
Superfamily SH2 domain 5.14e-48
Family SH2 domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 373-451
Classification Level Classification E-value
Superfamily RING/U-box 7.9e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 196-280
Classification Level Classification E-value
Superfamily EF-hand 1.5e-36
Family EF-hand modules in multidomain proteins 0.00000713
Further Details:      
 
Domain Number 5 Region: 875-910
Classification Level Classification E-value
Superfamily UBA-like 0.0000369
Family UBA domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62201339|gb|AAH93450|
Sequence length 923
Comment cbl-prov protein [Xenopus (Silurana) tropicalis]
Sequence
ISPSQPGAHREGCVRGPRVHQPQEFHPAAPRSLVTMATNLRKGGGLIGLVKDAFQPHHHH
PTAQPGAVDRKTVEKCWKLMDKVVRLCQNQRLALKNSPPYILDLLPDTYQHLRTIMSRYE
GKMEILGENEYFRVFMENLLKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLA
ELKAIFPNGQFQGDSFRITKADAAEFWRKAFGEKTIVPWKIFRLALHDVHPISSGLEAMA
LKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQK
FIHKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQALIDGFREGFYLFPDGR
NQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTS
CLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGGGMAELLRHCMDGTPSPCYDDDDDD
SGNDSIFVMKELAGAKVERPPSPLSATPQASLPPVPPRLDLLPQRAPNQSGACSPATSSK
ASSSSHHKDKPLPVPPTLRDLPPPPPPDRPHSMPCESRPQRRPLPSTPAEKPLPLPTNRP
GETWHPRAVPKAPASNLTPGDPWTGGRELTNRHSLPFTLPSHIDERRDRHGSTQSLDNTG
ISATTELFGGLDNDDAKMKPSSSANAIYSLATRPFPVSKPPTGDHVDSGDESEYMCPSSR
PLIPAAVPKSEARRPLETLPGLRPPDQQTERESYETMYNIQCQATNPVVVEPSREEETNS
AIANNGPENDDNEEDGYDIPKPHLPMAPARRTMSDAPNATPAFCSGAIGRDSGAGLLESS
QVPERPPKPFPRRMNSERRSVVGGGSGDAPPAPLSSEIESLLSQGYSQQDVNKALLIAHN
NIEMARNILREFVSIPSPAHVAT
Download sequence
Identical sequences Q566M6
gi|111305477|gb|AAI21225| gi|62201339|gb|AAH93450| ENSXETP00000046653 ENSXETP00000046653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]