SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62857687|ref|NP_001015965| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62857687|ref|NP_001015965|
Domain Number 1 Region: 255-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-39
Family Laminin G-like module 0.0000000262
Further Details:      
 
Domain Number 2 Region: 458-664
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.11e-28
Family Laminin G-like module 0.00000187
Further Details:      
 
Domain Number 3 Region: 42-93
Classification Level Classification E-value
Superfamily GLA-domain 4.21e-19
Family GLA-domain 0.00055
Further Details:      
 
Domain Number 4 Region: 89-233
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|62857687|ref|NP_001015965|
Domain Number - Region: 230-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000262
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62857687|ref|NP_001015965|
Sequence length 668
Comment growth arrest-specific 6 precursor [Xenopus (Silurana) tropicalis]
Sequence
MRTTSALTTTLLLTFLVAEPLHGTIVLSAKDASQFLRQRQRRANHIFEETKQGHLERECV
EEQCSKEEAREVFENDPETEYFYPKYLECNRRYRLLNRKDSLTTCIHNIPDQCSSAPCYR
EGSLNCIDLHGDFFCHCKPGWTGKSCSTDINECATDNGNCSQICVNKPGTYQCLCRSGYR
LHVNNKLCIDIDECAESRNICGTAQCKNVRSTYVCLCEDGYKYDELTKSCQDIDECLEGR
CEQTCVNSPGSYSCHCDGRGGVKLSQNMNTCEDILPCIPFASEKSRNSLYLGRMFSGTPV
IRLRFKRKQPTRLMAEFEFRTFDPEGVLFFAGGHQDSSWIVLALRNGRLELQLKYNGIGR
VTSSGPLINHGMWQAISVEELERNLVIKVNKDAVMKIAVSGDLFSVDKGLYQLNLTVGGI
PFKSSELVQSINPRLDGCMRNWNWLNGEDTSIQETVRMTEKMQCFLVAGRGSFFPGRGFA
LFHIDYTYPSKEESKANWRVEVNAQINPATDTGVLFALVSKDMAVPLSLALIDYHSTAKM
KRQFLIMSVENVVVSRIEIQVCDREHIVEISVSINDVFLSFDGTLGQKELDESQLQTTLL
LLNDHLEKGVKTYVGGLPDVAVTATPVTAFYHGCMTMKIQNKPLDLDDSVYKHNDITSHS
CPPIKSAK
Download sequence
Identical sequences Q28E66
NP_001015965.1.99540 XP_012812370.1.99540 XP_012812372.1.99540 XP_012812373.1.99540 gi|111307777|gb|AAI21224| gi|62857687|ref|NP_001015965| gi|89271915|gb|CAJ81661|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]