SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|62857767|ref|NP_001017235| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62857767|ref|NP_001017235|
Domain Number 1 Region: 210-477
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-78
Family Protein kinases, catalytic subunit 0.00000000121
Further Details:      
 
Domain Number 2 Region: 100-242
Classification Level Classification E-value
Superfamily SH2 domain 6.26e-39
Family SH2 domain 0.0000091
Further Details:      
 
Domain Number 3 Region: 41-124
Classification Level Classification E-value
Superfamily SH3-domain 6.28e-21
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62857767|ref|NP_001017235|
Sequence length 488
Comment v-yes-1 Yamaguchi sarcoma viral related oncogene homolog [Xenopus (Silurana) tropicalis]
Sequence
MGCIKSRQSTPQDDMGKNNPVSRTPSLLPGQKILQEIEEQGNIVIALYPYQGIHQDDLTF
KKGEKLKVIEEHGEWWKAKSLSSKKEGFIPSNYVARVNTLETEEWFFKDITRKDAERQLL
APGNNPGAFLIRESETSKGSYSLSIRDYDPKTGDVIKHYKIRTLDNGGYYISPRITFTSI
CDMIQHYQKQADGLCRKLDKPCYSPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMG
FYNNSTKVAVKTLKPGTMSVQAFMEEANLMKSLQHDKLVRLYAVVSKEEPIYIITEFMAK
GSLLDFLKSDEGAKVILPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSESLMCKIA
DFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGVLLYEIITTGKIPY
PGMSNSDVMTALQRGYRMPRMENCPVELYDIMKECWKEKAEERPTFDYLQSVLDDFYTAT
EAQYQQQP
Download sequence
Identical sequences Q28IV0
NP_001017235.1.99540 gi|62857767|ref|NP_001017235| gi|89268711|gb|CAJ83326|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]