SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66990093|gb|AAH98080| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66990093|gb|AAH98080|
Domain Number 1 Region: 40-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 124-171
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000106
Family Hairy Orange domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66990093|gb|AAH98080|
Sequence length 427
Comment basic helix-loop-helix family, member e41 [Xenopus (Silurana) tropicalis]
Sequence
MEEGIPSLQDRQLEPRDFLGMEYPHLFLCKPKRGLKRDESKETYKLPHRLIEKKRRDRIN
ECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKGLTSLTEQQHQKIMALQNGEHALK
SPIQTDLDAFHSGFQTCAKEVLQYLSRFESWTSRDQRCTQLLNHLHTVSSQILSSSQLLL
QSVPGGKGSSASPGRGGQKAENQTNCVPVIQRTHNLELNENDTDTDSGYGGEGEKAEGRS
DGQSSSGVKSQGGNSLTIKQEPMEEPSPKRFKPEFPGRGVTGPNAEPAVRPDAALLNSLM
AFGGAPFGQQAPFCLPFYFISPSAAAAAAYMPFLDKGSLEKYLYPAAAAAAAATPIPLLY
PGIPGQASGTFPCLSSVLSPEKMAACSSALLPELPSPPFQTGPAMDRGLTEELREPLEGL
LPPSKEN
Download sequence
Identical sequences Q4V788
NP_001027504.1.99540 gi|66990093|gb|AAH98080| gi|73853838|ref|NP_001027504|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]