SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85838730|gb|ABC86210| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85838730|gb|ABC86210|
Domain Number 1 Region: 55-428
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.96e-46
Family Integrin alpha N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 554-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000787
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85838730|gb|ABC86210|
Sequence length 647
Comment ASPIC [Xenopus (Silurana) tropicalis]
Sequence
MMLPADFFVPVSKMMLLALLLSIIICCGGAQRSEPMFTAVTDTVLPQDYDSNPTQLNYGV
AITDVDNDGDFEVVVAGYNGPNLVLKYIKEKGHLVNIAVDERSSPYYALRDRQGNAIGVA
ACDIDGDGREEIYFLNTNNAFSGIATYSDKLFTFRNGRWEDLFSDEVNLRRGVANRFSGR
SVACIDRKGSGRYSFYIANYANGNVGPHALIELDETASNLSRGIIVLSNVAAELGLNKYT
GGRGIAVGPIVNSAASDIFCDNENGPNFLFQNKGDGTFVDIASSTGVDDVYQHGRGVALA
DFNRDGKVDIVYGNWNGPHRLFLQMNTNGKVRFRDIATQKFSMPSPIRTVIAADFDNDQE
LEVFFNNIAYRGPSANRMFRVGRREHADPFMEELNPGDASEPDGRGTGGAVTDFDGDGML
DLILSHGESMAQPLSVFKGKQGLKNNWLRVIPRTKFGAFARGAKVVLYTKKSGAHLRIID
GGSGYLCEMEPVAHFGLGKDEASSLEVTWPDGKIFTRSVAEGEINSVLDIAYPHEDDTVT
KPTDIECGQGFSVNENGRCTDTDECIQFPFVCPREKPVCINTYGGYKCRPNRRCSRGFEP
NEDGTACVAQVAYFGSYPSSASRSQALFLHCTASLLGLGFYFQIYTL
Download sequence
Identical sequences Q0V9M0
gi|259586170|sp|Q0V9M0| gi|85838730|gb|ABC86210|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]