SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89267974|gb|CAJ81449| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89267974|gb|CAJ81449|
Domain Number 1 Region: 409-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-82
Family Protein kinases, catalytic subunit 0.000000000156
Further Details:      
 
Domain Number 2 Region: 911-1048
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.62e-59
Family FAT domain of focal adhesion kinase 0.000000238
Further Details:      
 
Domain Number 3 Region: 132-253
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-41
Family Second domain of FERM 0.000000385
Further Details:      
 
Domain Number 4 Region: 32-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-40
Family First domain of FERM 0.00000432
Further Details:      
 
Domain Number 5 Region: 254-362
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-36
Family Third domain of FERM 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89267974|gb|CAJ81449|
Sequence length 1054
Comment PTK2 protein tyrosine kinase 2 [Xenopus tropicalis]
Sequence
MAAAYLDPNLNHTPSTNAKSRLSTGMERSPGAIERVLRVFHYFESNNEPTTWSSNIRHGD
ATDVRGIIQKIVDSHKVKNVASFGLRLSHLYSEEVHWLHPDMGVSHVREKYEQSHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMSEIADQVDQEIALKLGCLEIRRSY
GEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRYDKECFKCALGSSWIISVELAIGPEEGISYLTDKGSNPTHLADFTQVQ
TIQYSSSEEKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVSGASESFII
RPQKEGERALPSIPKLANSEKHGVRAHAVSVSETDDYAEIIDEEDTYTMPSTGDYEIQRE
RIELGRCIGEGQFGDVHQGVYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSSDCVKLGDFGLSRYMEDSIYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMYGIKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKLQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFFPSPQHMVQPNHYQVSGFSISHGIPSMSGNLYPGQASVIDHMDSWNHRTPD
INMWQPGMEDSGPMDLRSMAQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSVDHVDGNLQCPAGNQHIYQPVGKPDHSAPPKKPLRPGAPSHLGNLPAHNSPVDSYNE
GVKPWRIQPQEISPPPTANLDRTNDKVYENVTGLVKAVIEMSSRIQPAPPDEYVPMVKGV
GLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQQEYK
KQMLTAAHALAVDAKNLLDVIDQARLRMISHSRP
Download sequence
Identical sequences Q28CP6
gi|89267974|gb|CAJ81449|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]