SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89268164|gb|CAJ81699| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89268164|gb|CAJ81699|
Domain Number 1 Region: 257-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-83
Family Protein kinases, catalytic subunit 0.00000000034
Further Details:      
 
Domain Number 2 Region: 147-291
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-40
Family SH2 domain 0.00000543
Further Details:      
 
Domain Number 3 Region: 72-198
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-27
Family SH3-domain 0.0000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89268164|gb|CAJ81699|
Sequence length 537
Comment Yamaguchi sarcoma viral (v-yes) oncogene homolog 1 [Xenopus tropicalis]
Sequence
MGCIKSKEDKGPSIKYRTEPKPDSGSQYGGDPTQATQSPGIKGPAPNFNSHSMTPFGGSS
GITPFGGASSIFSPTPVPYPGGLTGGVTVFVALYDYEARTTEDLSFRKGERFQIINNTEG
DWWEARSIATGKTGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGTFLVRE
SETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFESLQKLVKHYSEHADG
LCYRLTTVCPTVKPQTQGLSKDAWEIPRESLRLDVKLGQGCFGEVWIGTWNGTTKVAIKT
LKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEYMTKGSLLDFLKEGDGK
YLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEY
TVRQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVE
RGYRMPCPQGCPESLHELMKLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences Q28CN2
gi|89268164|gb|CAJ81699|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]