SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89273918|gb|CAJ81839| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89273918|gb|CAJ81839|
Domain Number 1 Region: 533-775
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-77
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 438-539
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000484
Family Scavenger receptor cysteine-rich (SRCR) domain 0.022
Further Details:      
 
Domain Number 3 Region: 390-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|89273918|gb|CAJ81839|
Sequence length 778
Comment novel trypsin family protein [Xenopus tropicalis]
Sequence
MSIGEEDVTIVVSSSTAGGDEGNGRVAQPSGPTRATAAVPTAVSAFTAHTSGPTRTSAPA
TSTPGPATSRPSGTPAPTTHNSGLISTASHTTGLTGTTSSTVNPTVPTASSSNIPRSMGT
TANATNPTVPTASSSNIPRSTGTTANATNPTVPTASSSNIPRSTGTTANATNPTVPTASS
SNIPRSTGTTANATNPTVPTTSSTSIPRSTGTTANATNPTVPTASSTNIPRSLGTTANAT
NPTVPTASSTNIPRSSGTTANSTNPTVPTASSTNIPRSSGTTANATNPTVPTRTPAASTH
TPNPTRTPVPTTHTPGPVRTPANAPRVPGPSRTPGPVRGTPRPVPKPPTSGPTVTYKKEK
AFPIRKYCVPTVAVLLVLASIAVIAILIKVVLDNYYFFCVKSFKFIPLDQWCDGKSDCTG
GEDESRCVQPFDVTTNSNVRFAEAGSVLQLYVQARSSWSFICNDNWDTNKAKAVCAQVGF
YSEPVSGTVSISDLSTSSALLYSTVQVLSDKSIQVNPTVWGSCTSGQVVSLRCAACGTGH
KQERIIGGSNSDILKYPWQVSLQYMGQHICGGSILNSRWILCAAHCFDRGQRQVDRWRVQ
YGITTLTYLFGTFVDKIFLNSKYVTDQKPNDIALLQLKSDIVASASVQPVCLPGYDNNLV
VGAVLYVTGWGHTVEGGAALASQLQEVAISLISSTTCNQEYGGQILDTMLCAGKIAGGAD
TCQGDSGGPLVSLGQSSHWEQVGIVSWGDGCGRPNRVGVYTDVQSFLNWIYGVMKQVP
Download sequence
Identical sequences Q28DA4
gi|113931254|ref|NP_001039074| gi|89273918|gb|CAJ81839| NP_001039074.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]