SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375141622|ref|YP_005002271.1| from Mycobacterium rhodesiae NBB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375141622|ref|YP_005002271.1|
Domain Number 1 Region: 16-266
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-23
Family Polyphosphate kinase C-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 258-424
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.41e-19
Family Nuclease 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375141622|ref|YP_005002271.1|
Sequence length 514
Comment phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthase [Mycobacterium rhodesiae NBB3]
Sequence
MSVLTDWFLTDEERGNPHSSLAGWCDGNRAEPLIHGATYFDHLVTEVEALRAGDHLFFTD
WRGDPDQKMREGGPTIRELFCRAAERGVVVKGLVWRSHLDKLAYSEEENRHLGEAIEEAG
GEVLLDQRVRIGGSHHQKLVVLRHPGAPERDVAFVGGIDLCHSRRDDASHRGDPQAVQMA
KRYGENPPWHDVQLRVQGPAVGALDTTFRERWQDPASLDMLNPLAWLRDKFGGADMNADP
LPDQPADPPPCGPHAIQVLRTYPDAHFAYDFAPHGERSIARAYNKVVPRARKLIYVEDQY
LWSKRVATLFAQALKDNPDLHLVAVIPRHPDVDGRLELPPNLIGRWQALETCHAASPERV
HIFDVENAEGTPVYVHAKVCVIDDVWSCVGSDNLNRRSWTHDSELTCAVLDAEGDFARDL
RLRLLREHLDRAADGSDDRGLGDPATAVREIVDAADGLEQWYASGRRGPRPPGRLRPHKA
ERPSLFTRLWAEPVYRLTYDPDGRSYRDRLRGRL
Download sequence
Identical sequences G8RP16
gi|375141622|ref|YP_005002271.1| WP_014212802.1.79459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]