SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|346725948|ref|YP_004852617.1| from Xanthomonas axonopodis pv. citrumelo F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|346725948|ref|YP_004852617.1|
Domain Number 1 Region: 25-61,89-178
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000968
Family SMI1/KNR4-like 0.013
Further Details:      
 
Domain Number 2 Region: 218-263,311-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000101
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|346725948|ref|YP_004852617.1|
Sequence length 372
Comment hypothetical protein XACM_3067 [Xanthomonas axonopodis pv. citrumelo F1]
Sequence
MAALKWMVYGRSPSLDTFWDDALNLGRVPATEAAIAAAQARLGVRLPAWLRELYARYDGG
AVQMARGQSLEEPDNWLKAEWLFPRARLLGSAELFSFAQVRAREEYRDDAFAGLAAGGDD
RHLIVIAADDRSPSRALCLDYSASGAEPTLVYVDAGDKHRLAVFANVEDLLAQLVDVHYW
SPALQARHGADVVQWQPQPPALTTFWSGADGRNDGGAAADADAFAEAEARLGVRLPALFK
RLYSVQDGGDTGWCWVPRTRFPSDHYVDWECVLVDRDLSPLAQIRSVLDFADAFEDRSDF
RAAACLHAGLDQVLVLSCHNVDSLLCLDYRARGPQCEPEVVYFENWEGLVPTWRAARFDA
FFAVLRQAELDV
Download sequence
Identical sequences G2LQN3
gi|346725948|ref|YP_004852617.1| WP_014090806.1.2230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]