SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|509154236|ref|YP_008074476.1| from Methanobrevibacter sp. AbM4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|509154236|ref|YP_008074476.1|
Domain Number - Region: 533-589
Classification Level Classification E-value
Superfamily EF-hand 0.000268
Family Calbindin D9K 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|509154236|ref|YP_008074476.1|
Sequence length 681
Comment hypothetical protein Abm4_0111 [Methanobrevibacter sp. AbM4]
Sequence
MINDLIEYGKWLSKNNLDDFGRNTKDKDYILLVNFNNKDFELIDFYKKETFDFNIYFNQS
IFHKDFFISTDQRFMIPSKSNLLGLSPFFIKLDNDFLTKKEFDKNKFNKFQNKIKRSIKA
NKNKKEFNAVLKDIYNDYNYFINSYPLNDSEKSYFLKFFKDYSYDKISSLIIKYYSFILE
KSEDISKKIINLKESDEFVKKDKSNFYLACCFSDELDLINDMFIYYSKIFKKRDEKVKNF
EEGYCSFCGKKTITYSSLGSYALSKSYSFNFSNKIDNAHLRICNECNSYLRTAEDNLKKN
LKAPIMIIPKSKGNNDYGSFAKISNTDKSSFSKINEFLKDNSNNFNYDLIFYNEGKGNTY
VINKYVENYQAFLVEFNKKIRLYDEDNCCNYLLNEHLNFDINNEKNYINNLFDLEPIFKS
FFINITKEGIQYPKLFNFYDIYLKDITGETGIFSGFDSKTVTIFVKYMNSIFSYIYELNT
DSLNRKMLNEIVLNLLLKYQKNTNNEKSYKNSIIQSLNYYYMLNKEFLEDKMLSENHIKE
LKNIFSKYNTNNNNKISTEDEEKIFNLIEEDYSLKYYLLGQFISLIDNSKRINNKNGEVF
SNFIINCNKYNILKLFATEVLQKNNYYIEKMNKKGKFIFKILEKDLNSLFNEDKFYFEDY
LLLIFTGYYTENILSSSYGSK
Download sequence
Identical sequences R9SH04
gi|509154236|ref|YP_008074476.1| WP_016357735.1.92605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]