SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|509154821|ref|YP_008075061.1| from Methanobrevibacter sp. AbM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|509154821|ref|YP_008075061.1|
Domain Number 1 Region: 151-279
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.28e-18
Family N-type ATP pyrophosphatases 0.039
Further Details:      
 
Weak hits

Sequence:  gi|509154821|ref|YP_008075061.1|
Domain Number - Region: 61-147
Classification Level Classification E-value
Superfamily EF-hand 0.00223
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|509154821|ref|YP_008075061.1|
Sequence length 355
Comment hypothetical protein Abm4_0725 [Methanobrevibacter sp. AbM4]
Sequence
MKITEDIILENINRIFKEIDHKEADINIKEIHYDEGLNELWIIGMDRPDKSAIIGKGGWI
VGRLKEDLDINSIHVESYTDFMQKEYRLKLSLDKVRRFQNTLNKEDDLYIPIENLKKTIQ
YKLENLSYFNLEKYLNENFRDNLDNVDNTTHKAVVALSGGVDSSFSLVLAQYLGFNPIAI
SVNPGTIVLPKQFRNNIDNICNQTGIQHRYIDIDYSELIKECLSGRIHPCGRCSKQIEST
IFDYAIENNIPIVIFGDMLSTGSQCITDNLYNNHNIKRLNLPASLSCGKIEGKKLMKDYN
FKEIKGFGCPLLYEVHRKYPHMRKYSIQRILRETRSGALEVGEALNLIWSFYKIK
Download sequence
Identical sequences R9SIT6
WP_016358320.1.92605 gi|509154821|ref|YP_008075061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]