SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|509155419|ref|YP_008075659.1| from Methanobrevibacter sp. AbM4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|509155419|ref|YP_008075659.1|
Domain Number - Region: 36-76
Classification Level Classification E-value
Superfamily 4-helical cytokines 0.00356
Family Short-chain cytokines 0.0086
Further Details:      
 
Domain Number - Region: 16-36
Classification Level Classification E-value
Superfamily EF-hand 0.0774
Family Calmodulin-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|509155419|ref|YP_008075659.1|
Sequence length 108
Comment hypothetical protein Abm4_1336 [Methanobrevibacter sp. AbM4]
Sequence
MPEFKLTYEASGTDCEIIMAIDYDDDGEVENQEFYTGSDWSDNPADLRENTTFICEEEEQ
EDLNNFFNGFMHLLESGELIEELKNLKEVDDSYIFSDEDIKVVLTEED
Download sequence
Identical sequences R9SL98
gi|509155419|ref|YP_008075659.1| WP_016358913.1.38678 WP_016358913.1.92605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]