SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|509155600|ref|YP_008075840.1| from Methanobrevibacter sp. AbM4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|509155600|ref|YP_008075840.1|
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 6.28e-122
Family Methyl-coenzyme M reductase gamma chain 0.00000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|509155600|ref|YP_008075840.1|
Sequence length 249
Comment methyl-coenzyme M reductase gamma subunit McrG [Methanobrevibacter sp. AbM4]
Sequence
MAQYYPGTSQVSENRRHFADPEQKLEKLREISDEDVVKILGHRAPGEEYKHVHPPLDEMD
EPDDIVRELVTPIDGAKAGDRVRYIQFADSMYFAPVQPYVRARSYMNRYRGIDTGTLSGR
QVIEARERDLEKLSKELLETEYFDPARTGIRGKSVHGHSLRLDEDGIMFDMLRRQLKNKE
TGHIEMVKNQIAIPLDEPIDIGEPLDEEKLKSITTIYRVDGDKYRDDKDAVEVLHKIHLT
RTQGGYNPE
Download sequence
Identical sequences R9SN08
WP_016359093.1.92605 gi|509155600|ref|YP_008075840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]