SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383321574|ref|YP_005382427.1| from Synechocystis sp. PCC 6803 substr. GT-I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383321574|ref|YP_005382427.1|
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0000000000000638
Family HMA, heavy metal-associated domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383321574|ref|YP_005382427.1|
Sequence length 64
Comment hypothetical protein SYNGTI_0665 [Synechocystis sp. PCC 6803 substr. GT-I]
Sequence
MTIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAG
HEVE
Download sequence
Identical sequences L8AHW8 P73213
000005147|e1sb6A1|304.3.1.7|A:1-64 cath|current|1sb6A00/1-64 cath|current|2xmjA00/2-64 cath|current|2xmjB00/2-64 cath|current|2xmkA00/1002-1064 cath|current|2xmkB00/2002-2064 cath|current|2xmtA00/2-64 cath|current|2xmtB00/2-64 cath|current|2xmuA00/2-64 cath|current|2xmuB00/2-64 d1sb6a_ 1sb6_A 2xmj_A 2xmj_B 2xmk_A 2xmk_B 2xmt_A 2xmt_B 2xmu_A 2xmu_B gi|16329832|ref|NP_440560.1| gi|16329832|ref|NP_440560.1| gi|383324743|ref|YP_005385596.1| 1sb6A gi|383321574|ref|YP_005382427.1| gi|383490627|ref|YP_005408303.1| CIRMMP34 1148.ssr2857 WP_010871869.1.11876 WP_010871869.1.1889 WP_010871869.1.18904 WP_010871869.1.33690 WP_010871869.1.35395 WP_010871869.1.47586 WP_010871869.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]