SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383323086|ref|YP_005383939.1| from Synechocystis sp. PCC 6803 substr. GT-I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383323086|ref|YP_005383939.1|
Domain Number 1 Region: 215-381
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-44
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 2 Region: 8-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-28
Family KaiB-like 0.0013
Further Details:      
 
Domain Number 3 Region: 141-222
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000451
Family Homodimeric domain of signal transducing histidine kinase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383323086|ref|YP_005383939.1|
Sequence length 383
Comment sensory transduction histidine kinase SasA/Hik8 [Synechocystis sp. PCC 6803 substr. GT-I]
Sequence
MSSSSELGNASSVPLQFLLFIDDRPNSQDSVQEIGQCLTNLLDGHSHDLQILQISKHPHL
VEHFRLVATPSLIKLQPEPRQVLAGSNIIQQLQKWWPRWQQELAMDPNPEDTGQSPSCPR
EISSVGYSGELMKMSDELFLLKKDKEELLQQIQFKDQILAMLAHDLRSPLTAASIAVDTL
ELLQHKPIEEQKPALRSQLLYQARKQFKIMDRLIEDILQASKNLNSQFQVHGRPLAIADL
CQEVLELYQAKFSKKNLTITYDIPKDLPNVFADEELIRQVIANLLDNAIKYTPAHGSITV
GALHRTTQKVQVSITDNGPGIPNSKQETIFEGHFRLQRDEQTDGYGLGLSLCRKIIQAHY
GQIWVDSRPKQGSSFHFTLPVYR
Download sequence
Identical sequences L8ASN5 Q55630
gi|16331345|ref|NP_442073.1| gi|383323086|ref|YP_005383939.1| 1148.sll0750 WP_010873372.1.11876 WP_010873372.1.1889 WP_010873372.1.18904 WP_010873372.1.33690 WP_010873372.1.35395 WP_010873372.1.47586 WP_010873372.1.99424 gi|383326255|ref|YP_005387108.1| gi|383492139|ref|YP_005409815.1| gi|16331345|ref|NP_442073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]