SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379006053|ref|YP_005255504.1| from Sulfobacillus acidophilus DSM 10332

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379006053|ref|YP_005255504.1|
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.19e-43
Family N-utilization substance G protein NusG, N-terminal domain 0.0000228
Further Details:      
 
Domain Number 2 Region: 119-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.03e-16
Family N-utilization substance G protein NusG, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379006053|ref|YP_005255504.1|
Sequence length 176
Comment transcription antitermination protein nusG [Sulfobacillus acidophilus DSM 10332]
Sequence
MEKDWYVIHTYSGYENKVKANLERRVASMGMEDKIFRIMVPMEEELEVKDGKKKLVKKKV
FPGYVLVEMILTDDSWYVVRNTPGVTGFVGSGSKPIPLLDHEVRMILGRDLSGVPELPRV
NFSVGQEVLVREGPFEGFSGKIEEIYPDRGKVRLTVSMFGRDTPLELDFTQVSELE
Download sequence
Identical sequences G8TWY4
gi|379006053|ref|YP_005255504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]